Orientador: Benedito de Oliveira Filho / Tese (doutorado) - Universidade Estadual de Campinas, Instituto de Biologia / Made available in DSpace on 2018-07-23T21:32:03Z (GMT). No. of bitstreams: 1
Lima_JoseAugustoFerrazde_D.pdf: 9723365 bytes, checksum: 7a7e5a81f0a1e933d7b4f6a5dcb3d1bb (MD5)
Previous issue date: 1998 / Resumo: O pacu Piraractus mesopotamicus Holmberg, 1887 (Characiformes, Characidae, Serrasalminae) é um peixe teleósteo de água doce, que no seu habitat natural alimenta-se preferencialmente de frutas. Tal qual o tambaqui Colossoma macropomum, o pacu encontra-se classificado, junto com a carpa Cyprinus carpio e o bagre americano Ictalurus punctatus, na superordem Ostariophysi. O tecido pancreático do pacu, semelhante ao tambaqui, exibe uma ilhota principal e pequenos corpos de Brockman. As ilhotas pancreáticas do pacu foram analisadas histologicamente e mostraram os quatro tipos de células endócrinas encontradas nas ilhotas de Langerhans dos mamíferos. Hormônios polipeptídeos, de um extrato de ilhotas principais de pacu, foram purificados com elevado rendimento em fase reversa de HPLC e suas estruturas primárias foram determinadas por degradação automática de Edmann. A estrutura primária da insulina do pacu, foi determinada como - Cadeia A: GIVEQCCHKPCSIFDLQNYCN; Cadeia B: NAGAPQHLCGSHLVDALYLVCGPSGFFYNPK. Em comparação com a insulina da carpa a insulina do pacu contém apenas duas substituições (Glu -+ Asp em AiS e Thr -+ Ser em B24). Comparada com a insulina humana, ambas, contém uma. extensão dipeptídica no N terminal e uma deleção do resíduo C terminal. A insulina do pacu mostrou ser idêntica à insulina do tambaqui o pâncreas do pacu, também sintetiza glucagon e GLP-1. A estrutura primária do glucagon do pacu foi estabelecida como: SEGTFSNDYSKYLETQRAQDFVQWLMNS. O glucagon do pacu difere do glucagon humano, em 7 substituições de aminoácidos e do glucagon do bagre americano por uma simples substituição na posição 17{Arg _ Gln). Um resíduo Gln, nesta posição, nunca foi observado, préviamente, para nenhum glucagon de teleosteos ou de mamíferos. A estrutura primária do peptídeo "glucagon-like" GLP) do pacu foi determinada como: HADGTYTSDVSA YLQDQAAKDFITWLKSGQPKQE. O GLP do pacu contém 34 resíduos de amino ácidos e difere do GLP do bagre americano apenas na posição 12 (Ser - Ala) e 33 (Pro - Gln). Em comum com outras espécies de teleósteos, o pacu expressa dois genes para somatostatina. A somatostatin-14, derivada da preprosomatostatina-I (PSS-I), é idêntica à somatostatina-14 dos mamíferos e do bagre americano, Um fragmento de prosomatostatina-22 mostrou 67% de identidade seqüencial com os resíduos (1-58) da preprossomatostatina (PSS-II) do bagre americano. A comparação da estrutura primária dos hormônios das ilhotas sugere que a seqüência de aminoácidos tem sido mais conservada entre os Ostariophysi que entre os outros grupos, já estudados, do taxon Euteleostei / Abstract: The fruit-eating teleost fish, the pacu Piaractus mesopotamicus Holmberg, 1887 (Characiformes, Characidae, Serrasalminae), similarly to tambaqui Colossoma macropomum, is classified with the carp and the catfish in the superorder Ostariophysi. The pacu and tambaqui have the pancreatic tissue exibiting both principal islet and small Brockmann bodies (Bbs). The pacu Bbs were analyzed histologically and shown to contain four kinds of endocrine cells (A. B, C, O) found in mammalian islets of Langerhans. Hormonal polypeptide in an extract of pacu Brockmann bodies were purified to homogeneity in high yeld by reversed phase HPLC and their primary structures determined by automated Edman degradation. The primary structure of pacu insulin was established as ¿ A chain: GIVEQCCHKPCSIFDLQNYCN, B-chain: NAGAPQHLCGSHLVDALYLVCGPSGFFYNPK. Pacu and tambaqui insulin are identical, they contain only two substitutions (Glu _ Asp at A15 and Thr _ Ser at B24) compared with carp insulin. The B-chains of both insulins contain a dipeptide extension in the N terminus and a deletion of the C terminal residue compared with human insulin. The pacu pancreas also synthesizes glucagon and GLP-1. The primary structure of pacu glucagon was established as: HSEGTFSNDYSKYLETQRAQDFVQWLMNS. Pacu glucagon differs from human glucagon by 7 amino acids and from catfish glucagon by a single substitution at position 17(Arg _ Gln). A Gln resídue at this position has not been observed previously in any teleostean or mammalían glucagon. The primary structure of pacu glucagon-Iíke peptide (GLP) was established as: ADGTYTSDVSAYLQDQAAKDFITWLKSGQPKQE. Pacu GLP contains 34 amino acid residues and differs from catfish GLP only at positions 12 (Ser - Ala) and 33 (pro - Gln). In common with other teleost species, the pacu expresses two somatostatin genes. Somatostatin-14, derived from preprosomatostatin-I (PSS-I), is identical to mammalían and catfish somatostatin-14. A fragment of prosomatostatin-22 showed 67% sequence identity with residues (1-58) of catfish preprosomatostatin-II (PSS-II). A comparison of the primary structures of the islets hormones suggest that amino acid sequences may have been more conserved within the Ostariophysi than in other groups of the taxon Euteleostei, that have been studied. Isolation of these hormones will now permit an investigation of their effect on lipide and carbohydrate metabolism in the serrasalminae fishes, pacu and tambaqui / Doutorado / Fisiologia / Doutor em Ciências Biológicas
Identifer | oai:union.ndltd.org:IBICT/oai:repositorio.unicamp.br:REPOSIP/313986 |
Date | 03 July 1998 |
Creators | Lima, Jose Augusto Ferraz de |
Contributors | UNIVERSIDADE ESTADUAL DE CAMPINAS, Oliveira Filho, Benedito, 1930-, Filho, Benedito de Oliveira, Boschero, Antonio Carlos, Krieger, Marta Helena, Reis, Norair Salviano dos |
Publisher | [s.n.], Universidade Estadual de Campinas. Instituto de Biologia, Programa de Pós-Graduação em Ciências Biológicas |
Source Sets | IBICT Brazilian ETDs |
Language | Portuguese |
Detected Language | English |
Type | info:eu-repo/semantics/publishedVersion, info:eu-repo/semantics/doctoralThesis |
Format | 92f. : il., application/pdf |
Source | reponame:Repositório Institucional da Unicamp, instname:Universidade Estadual de Campinas, instacron:UNICAMP |
Rights | info:eu-repo/semantics/openAccess |
Page generated in 0.0028 seconds