Spelling suggestions: "subject:"[een] DIE"" "subject:"[enn] DIE""
121 |
Die Ondersoek van 'n moontlike materiaal - afhanklike verklaring van die Coulomb-Navier interne wrywingskoëffisiëntVan der Merwe, Pieter January 1976 (has links)
Die onbevredigende konsep van die interne wrywingskoeffisient
wat as basis dien vir numeries-bruikbare fraktuurkriteria vir
brosmateriale, onder andere die van Coulomb-Mohr, impliseer
dat daar meriete in die kriteria bestaan, maar dat daar ook
fundamentele aspekte van die fraktuur.meganika vir brosmateriale
bestaan wat nog ontsluit moet word. Met hierdie as onderliggende
behoefte, word die probleem geidentifiseer deur
eers die waarskynlike tekortkominge in die interpretasie van
die bestaande teoriee in oenskou te neem.
So word byvoorbeeld die rol van die inter.mediere hoofnormaalspanning
met behulp van die stereografiese projeksiemetode
geillustreer waaruit afgelei kan word dat die probleem,
in teenstelling met die opinie van sommige ander navorsers,
wel drie-dimensioneel van aard is. Daar word oak aangetoon dat die gemiddelde normaalspanningsvlak
meganistiese eienskappe bevat wat daarop dui dat
dit die kritieke fraktuurvlak kan wees. Aangesien hierdie
vlak egter invariant ten opsigte van die normaalspanningsverwysingsnetwerk
is, word die begrip netto-normaalspanning
ingevoer wat 'n funksie van die Poissonverhouding is.
Deur 'n funksionele verwantskap af te lei vir die
helling van die Mohrenvelop wat die Mohrsirkel raak by die
punt wat verteenwoordig word deur die gemiddelde netto-hoofnor.
maalspanning in terme van die normaalspannings en die
Poissionverhouding, word 'n moontlike materiaal-afhanklike
verklaring van die interne wrywingskoeffisient verkry.
Dit word bevind dat hierdie vergelyking sinvolle waardes
van die interne wrywingskoeffisient voorspel, wat impliseer
dat daar meriete in die benaderingswyse bestaan wat die
formulering van die verwantskap voorafgegaan het. 'n Uitvloeisel
van die benaderingswyse is dat dit aanleiding gee
tot 'n gewysigde vorm van voorstelling van eksperimentele
data. Daar word bevind dat die gewysigde voorstelling baie gevoelig is vir sekere veranderlikes en die rol van invariante
toestande word ook deur hierdie voorstelling beklemtoon.
'n Afleiding wat uit hierdie verhandeling gemaak kan
word, is dat dit moontlik behoort te wees om 'n fraktuurkriterium
in terme van elastisiteitskonstantes te formuleer. / Dissertation (MSc)--University of Pretoria, 1976. / gm2014 / Mechanical and Aeronautical Engineering / Unrestricted
|
122 |
Verhale as singewing : Alexander Strachan en Cormac McCarthyPretorius, Charmain 27 August 2012 (has links)
M.A. / Even at a superficial glance there seems to be remarkable similarities between the "Border trilogy" of the American author Cormac McCarthy and the work of the Afrikaans author Alexander Strachan. The last three novels by McCarthy, All the Pretty Horses (1992), The Crossing (1994) and Cities of the Plain (1999), are referred to as the "Border trilogy". The first three novels by Strachan are also sometimes referred to as a "trilogy". Frontiers/borders are important in the novels under discussion: The Crossing (1994), Die jakkalsjagter (1990) and Die werfbobbejaan (1994). The Crossing is the second novel of the 'Border trilogy". The title of Strachan's fist work is 'n Wereld sonder grense ("A world without borders"). In The Crossing tracking a wolf plays an important role while Die jakkalsjagter is about hunting a jackal. Die werfbobbejaan is about hunting down a baboon. Both McCarthy's and Strachan's works have been compared to the Western (films/novels dealing with the cowboys of North America). These superficial similarities seem to invite further comparison. The following themes are present in both authors' works and are compared in this study: The world can never be known The world is incomprehensible. It is constantly changing and always out of reach. The world is like "a snowflake" and like "breath" and cannot be held, because it only exists in people's hearts. The world is also incomprehensible in Strachan's work, because all certainties are undermined. Khera cannot understand Zuhiland in the same "logical" way that she could understand her world in Cape Town. The strange stories told by the people in Zululand (izinganekwane) make her aware of supernatural powers. Nothing can really be known about the world. The story that the witness tells becomes the world All objects are without meaning unless their stories are known. Truth is only to be found in narration. The world exists in narration. Therefore "the witness is all". Free will and predetermination The view of the world and our destiny in the world in The Crossing is compared with the view of the world in Die jakkalsjagter and Die werfbobbejaan. There is not one final answer to the question of determinism and free will in The Crossing. On the one hand it seems that history happens according to a predetermined plan of God. On the other hand it seems that human beings can make decisions and be in control. In this novel we find the idea that the future and the past can only be known as it exists in the present. The Strachan novels, Die jakkalsjagter en Die werfbobbejaan, reflect a certain determinism. Everything heads towards a final showdown with the death of the old man in the sod house. Khera's actions are predetermined. Things happen without her intention. The importance of stories is found in all three novels under discussion, The Crossing, Die jakkalsjagter and Die werfbobbejaan. "Things separate from their stories have no meaning. They are only shapes. Of a certain size and color. A certain weight. When their meaning has become lost to us they no longer have even a name. The story on the other hand can never be lost from its place in the world for it is that place" (Crossing: 142-143). The importance of the story is that it gives meaning to the things. All stories are the same story. The izinganekwane could be parallelled to the corrido (Spanish tales). Both are part of a hostile country, a different language and both are old tales that seem to determine the future.
|
123 |
Výroba opěry objemovým tvářením / Production of support by solid formingPfeifer, František January 2009 (has links)
PFEIFER František: Production of support by solid forming. A Graduation Thesis of Master´s Studies, the 5th Year of Study, the School-year 2008/2009, FSI VUT Brno, Department of Machining, May 2009, Pages No. 94, Pictures No. 37, Tables No. 3, Appendixes No. 13. The Graduation Thesis, elaborated in the framework of engineering studies, presents the production technology of support component from steel ČSN 12 010. A material is a rod of the 130 – 251 ČSN 42 5510. A yearly production is 95 000 pieces. Based on the studies of possible production technologies was proposed the technology of production by the vertical forging press LMZ 6500B (Šmeral Brno a. s.) with a nominal forming power of 65 MN, flash and pellicle trimming on a trimming press with a nominal power of 8 MN. For this option, the required technological calculations, the design of the die, the specification of production machines and a simulation forming process which is made in the software QFORM have been carried out.
|
124 |
Improving the Fatigue Life of Cylindrical Thread Rolling DiesWillens, David C. 14 May 2020 (has links)
Thread rolling is a unique metal forming process which is commonly used to form screw threads on threaded fasteners and precision leadscrews at relatively high rates of speed. Threads are formed on a cylindrical blank by flat or cylindrical dies having the reverse form on them, which rotate and penetrate the blank simultaneously, to plastically deform it into a precise geometry. Thread rolling dies are exposed to a complex state of cyclical contact stresses that eventually cause the dies to fail by fatigue and wear. The stress state is not easily ascertained through standard analytical models due to complex geometry and process conditions. This research seeks to better understand the state of contact stresses present in cylindrical thread rolling dies as they form material, to aid in identifying and testing economical methods of improving thread rolling die fatigue life. Some work has been published on using FEA simulation software to model the thread rolling process, but no work has been published on using FEA software to analyze the stresses in thread rolling dies. DEFORM®-3D Forming Simulation Software by Scientific Forming Technologies Corporation in Columbus, Ohio was used to simulate the throughfeed thread rolling process and model the state of stresses in the dies. The results were compared to the Hertzian contact stress model and the Smith Liu equations for rolling and sliding friction. Fatigue life prediction methods involving S-N curves, surface fatigue strength, and Weibull probability distributions were tested using the simulation data against field results. An optimized die design was generated from a design of experiments simulating different die design geometry. Findings show that field failures correlate well to the DEFORM® simulation results. The Hertz model with Smith Liu equations improved correlation with the simulation. Fatigue life prediction models correlated reasonably well to field results using the simulation data for inputs. These findings can aid in selecting appropriate die materials, design parameters, and fatigue life treatments.
|
125 |
Das Erhabene in Haydns Oratorien «Die Schöpfung» und «Die Jahreszeiten»Webster, James 20 December 2019 (has links)
No description available.
|
126 |
Heat Treatment Optimization of Inconel 718 Cladded H13 Forging DiesWashburn, Aaron January 2018 (has links)
No description available.
|
127 |
Preliminary Research for the Development of a Hot Forging Die Life Prediction ModelGrobaski, Thomas 18 December 2004 (has links)
No description available.
|
128 |
An analysis, design, and improvement methodology for shape rolling processes and procedures for the compensation of diesBelinski, Robert A. January 1999 (has links)
No description available.
|
129 |
Das ”Grundphänomen der Geschichte”: Zur Rolle der Geschichtlichkeit beim frühen HeideggerMaass, Holger 28 May 2024 (has links)
In den folgenden Überlegungen soll gezeigt werden, daß das Problem
der Geschichtlichkeit in Heideggers ”Sein und Zeit” nicht nur eine
ergänzende Beigabe darstellt, sondern den systematischen Ansatz der
Daseinsanalyse erst zum Abschluß bringt. Dazu werden neuere
Interpretationsmöglichkeiten aufgegriffen, wie sie innerhalb der
Analytischen Philosophie entwickelt worden sind. In diesem Rahmen
wird Heideggers Denken als zum einen sozial-pragmatisch und zum
anderen zeitlich fundierte Transzendentalphilosophie begreifbar, in der
die Geschichtlichkeit ganz folgerichtig eine Schlüsselrolle einnimmt.
|
130 |
Processing and Properties of Die-attachment on Copper Surface by Low-temperature Sintering of Nanosilver PasteZheng, Hanguang 30 May 2012 (has links)
As the first level interconnection in electronic packages, chip attachment plays a key role in the total packaging process. Sintered nanosilver paste may be used as a lead-free alternative to solder for die-attachment at sintering temperature below 300 °C without applying any pressure. Typically, the substrate, such as direct bond copper (DBC) substrates, has surface metallization such as silver or gold to protect the copper surface from oxidation during the sintering process. This study focused on developing techniques for die-attachment on pure copper surface by low-temperature sintering of nanosilver paste. One of the difficulties lies in the need for oxygen to burn off the organics in the paste during sintering. However, the copper surface would oxidize, preventing the formation of a strong bond between sintered silver and copper substrate.
Two approaches were investigated to develop a feasible technique for attachment. The first approach was to reduce air pressure as a means of varying the oxygen partial pressure and the second approach was to introduce inert gas to control the sintering atmosphere. For the first method, die-shear tests showed that increasing the oxygen partial pressure (PO₂ from 0.04 atm to 0.14 atm caused the bonding strength to increase but eventually decline at higher partial pressure. Scanning electron microscopy (SEM) imaging and energy dispersive spectroscopy (EDS) analysis showed that there was insufficient oxygen for complete organics burnout at low PO₂ condition, while the copper surface was heavily oxidized at high PO₂ levels, thus preventing strong bonding. A maximum bonding strength of about average 8 MPa was attained at about PO₂ = 0.08 atm. With the second method, the die-shear strength showed a significant increase to about 24 MPa by adjusting the oxygen exposure temperature and time during sintering.
The processing conditions necessary for bonding large-area chips (6 mm à 6 mm) directly on pure copper surface by sintering nanosilver paste was also investigated. A double-print process with an applied sintering pressure of less than 5 MPa was developed. Die-shear test of the attached chips showed an average bonding strength of over 40 MPa at applied pressure of 3 MPa and over 77 MPa under 12 MPa sintering pressure. SEM imaging of the failure surface showed a much denser microstructure of sintered silver layer when pressure was applied. X-ray imaging showed a bond layer almost free of voids. Because the samples were sintered in air, the DBC surface showed some oxidation. Wirebondability test of the oxidized surface was performed with 250 μm-diameter aluminum wires wedge-bonded at different locations on the oxidized surface. Pull test results of the bonded wires showed a minimum pull-strength of 400 gram-force, exceeding the minimum of 100-gf required by the IPC-TM-650 test standard. / Master of Science
|
Page generated in 0.0554 seconds