Schichten auf Basis von Molybdändisilizid werden mittels Hochgeschwindigkeitsflammspritzens an Stelle der heute gebräuchlichen Plasmaspritzverfahren erzeugt. Für die Herstellung der Spritzpulver kommen die Hochenergiemahlung und anschließend das drucklose Sintern zum Einsatz. Zur gezielten Einstellung der Schichtporosität werden relevante Prozessparameter mit Hilfe der statistischen Versuchsplanung ermittelt. Anschließend erfolgt die Abscheidung von MoSi2-Schichten mit unterschiedlichen Porositätsniveaus. Als für die Nutzung von Molybdändisilizidschichten im Hochtemperaturbereich relevanteste Systemeigenschaft wird das Oxidationsverhalten bei unterschiedlichen Temperaturen im Bereich von 500 °C bis 1500 °C untersucht. Dafür kommen thermogravimetrische Methoden, Temperaturwechselfestigkeits- und Thermoschockversuche zur Anwendung. Ein Praxistest in einer Hausmüllverbrennungsanlage prüft die Korrosionsbeständigkeit der MoSi2-Beschichtungen in einer möglichen Anwendung. Zusätzlich zur Analyse der Schichtgefüge mit licht- und elektronenmikroskopischen Verfahren, Röntgenfeinstrukturanalyse und Sauerstoffgehaltsmessungen werden die mechanischen Kennwerte Oberflächenrauheit und Mikrohärte bestimmt. Die Untersuchungsergebnisse weisen nach, dass hochgeschwindigkeitsflammgespritzte Molybdändisilizidschichten nach entsprechender Gefügeoptimierung im Temperaturbereich von 500 °C bis 1500 °C, vor allem bei Temperaturen oberhalb von 1200 °C, als Oxidationsschutzschichten empfohlen werden können.

No / This study investigates the effect of heat treatment on changes in microstructure and wear behaviour of WC-NiCr coatings. Two feedstock powders with a similar chemical composition and different particle sizes (near nano-structured WC-17NiCr and microstructured WC-15NiCr) were used. High-velocity oxyfuel spraying technique was used to deposit coatings on to a mild steel substrate using identical spraying parameters. Coated samples were then heat treated in a nitrogen atmosphere at 500 and 700°C. The effect of heat treatment on changes in hardness and wear performance of the coatings was studied using microstructural analysis, micro-hardness indentation and abrasive wear tests. The results showed that the heat treatment increased the hardness of both coatings and a corresponding increase in wear resistance was recorded. The formation of a brittle CrWO4 phase in the microstructured coating resulted in brittle fracture of the coating and this gave lower wear resistance compared to the nanostructured coatings.

Neste trabalho, estudou-se a viabilidade da aplicação de revestimentos de ferro fundido branco multicomponente (FFBMC) pelo processo de aspersão térmica por chama hipersônica (HVOF). A melhor condição de aspersão, variando-se a vazão e razão dos gases oxigênio e propano, a distância de aspersão e a granulometria do pó, foi utilizada para aplicação dos revestimentos em substratos de aço e de FFBMC com e sem preaquecimento. Caracterizaramse os revestimentos de FFBMC em relação ao teor de carbono, temperatura final, espessura, porosidade, dureza, aderência, perda de massa, coeficiente de atrito e mecanismo de desgaste abrasivo. Os revestimentos com menor porosidade e maior dureza foram aqueles depositados com razão oxigênio/propano de 4,6, 200 mm de distância de aspersão e granulometria entre 20 e 45 μm. Com esses parâmetros obtiveram-se revestimentos com aderência de 84 MPa, em substratos de aço sem preaquecimento e temperatura final de 200 °C, sendo que o fator mais importante no valor da aderência foi a temperatura final do revestimento. Além disso, a perda de massa foi semelhante aos valores obtidos para amostras de FFBMC fundidas, temperadas e revenidas. Os fatores responsáveis por estes valores foram a eliminação da austenita retida e a sinterização das partículas do revestimento quando as amostras foram temperadas e revenidas. O mecanismo de desgaste predominante foi o microcorte associado à fratura das lamelas próximas das partículas não fundidas, poros de aspersão e dos vazios formados no processo de desgaste. Considerando os níveis de aderência e perda de massa obtidas neste trabalho é viável a aplicação de FFBM por aspersão térmica HVOF. / In this work, the viability of the application of multicomponent white cast iron coatings was studied using high velocity oxygen fuel thermal spray process. The best spray condition, varying the oxygen and propane flow rate, the oxygen/propane ratio, the spraying distance and the powder size, was used for the application of coatings in steel and multicomponent white cast iron substrates with and without preheating. Carbon content, final temperature, thickness, porosity, hardness, adherence, mass loss, friction coefficient and abrasive wear mechanism of the coatings were characterized. The coatings that presented lower porosity and greater hardness were those deposited with oxygen/propane ratio of 4.6, spraying distance of 200 mm and powder size between 20 and 45 μm. With these parameters, coatings with adherence of 84 MPa in steel substrate, without preheating and final temperature of 200 °C, were obtained. The final temperature was identified as the most important factor for the adherence value. Moreover, the coating mass loss was similar to the multi-component white cast iron substrate tempered and annealed. The factors responsible for the high adherence and lower mass loss were the elimination of the retained austenite and the sintering of particles of the coating when the samples were tempered and annealed. The predominant wear mechanism was microcutting associated with the fracture of the lamellae near to unmelted particles, pores of spraying process and the voids formed in the wear process. Considering the levels of adherence and mass loss verified in this work, the application of multicomponent white cast iron coatings using high velocity oxygen fuel thermal spray process is viable.

Neste trabalho, estudou-se a viabilidade da aplicação de revestimentos de ferro fundido branco multicomponente (FFBMC) pelo processo de aspersão térmica por chama hipersônica (HVOF). A melhor condição de aspersão, variando-se a vazão e razão dos gases oxigênio e propano, a distância de aspersão e a granulometria do pó, foi utilizada para aplicação dos revestimentos em substratos de aço e de FFBMC com e sem preaquecimento. Caracterizaramse os revestimentos de FFBMC em relação ao teor de carbono, temperatura final, espessura, porosidade, dureza, aderência, perda de massa, coeficiente de atrito e mecanismo de desgaste abrasivo. Os revestimentos com menor porosidade e maior dureza foram aqueles depositados com razão oxigênio/propano de 4,6, 200 mm de distância de aspersão e granulometria entre 20 e 45 μm. Com esses parâmetros obtiveram-se revestimentos com aderência de 84 MPa, em substratos de aço sem preaquecimento e temperatura final de 200 °C, sendo que o fator mais importante no valor da aderência foi a temperatura final do revestimento. Além disso, a perda de massa foi semelhante aos valores obtidos para amostras de FFBMC fundidas, temperadas e revenidas. Os fatores responsáveis por estes valores foram a eliminação da austenita retida e a sinterização das partículas do revestimento quando as amostras foram temperadas e revenidas. O mecanismo de desgaste predominante foi o microcorte associado à fratura das lamelas próximas das partículas não fundidas, poros de aspersão e dos vazios formados no processo de desgaste. Considerando os níveis de aderência e perda de massa obtidas neste trabalho é viável a aplicação de FFBM por aspersão térmica HVOF. / In this work, the viability of the application of multicomponent white cast iron coatings was studied using high velocity oxygen fuel thermal spray process. The best spray condition, varying the oxygen and propane flow rate, the oxygen/propane ratio, the spraying distance and the powder size, was used for the application of coatings in steel and multicomponent white cast iron substrates with and without preheating. Carbon content, final temperature, thickness, porosity, hardness, adherence, mass loss, friction coefficient and abrasive wear mechanism of the coatings were characterized. The coatings that presented lower porosity and greater hardness were those deposited with oxygen/propane ratio of 4.6, spraying distance of 200 mm and powder size between 20 and 45 μm. With these parameters, coatings with adherence of 84 MPa in steel substrate, without preheating and final temperature of 200 °C, were obtained. The final temperature was identified as the most important factor for the adherence value. Moreover, the coating mass loss was similar to the multi-component white cast iron substrate tempered and annealed. The factors responsible for the high adherence and lower mass loss were the elimination of the retained austenite and the sintering of particles of the coating when the samples were tempered and annealed. The predominant wear mechanism was microcutting associated with the fracture of the lamellae near to unmelted particles, pores of spraying process and the voids formed in the wear process. Considering the levels of adherence and mass loss verified in this work, the application of multicomponent white cast iron coatings using high velocity oxygen fuel thermal spray process is viable.

Das thermische Spritzen ist ein industrieller Beschichtungsprozess, der hauptsächlich zum Schutz oder zur Funktionalisierung von Bauteiloberflächen eingesetzt wird. In der Regel werden mit diesem Verfahren Schichten mit einer Dicke von 50 bis zu einigen 100 Mikrometern aufgetragen, die überwiegend durch mechanische Verklammerung haften, wodurch die Materialeigenschaften des Bauteils weitgehend erhalten bleiben. Mit der Einführung von Suspensionen als neue Kategorie der Spritzzusätze etabliert sich gerade eine der weitreichendsten Innovationen der letzten Jahre auf dem Gebiet des thermischen Spritzens. Suspensionen sind Stoffgemische, die aus einer feindispersen, festen Phase, dem Schichtwerkstoff, und einer flüssigen Phase als Trägermedium bestehen. Damit können Partikel mit geringerer Größe in den Beschichtungsprozess eingebracht werden, so dass sich dünnere Schichten und feinere Mikrostrukturen realisieren lassen. Das thermische Spritzen mit Suspensionen erweitert damit den Anwendungsbereich und bildet eine Brückentechnologie zu den Vakuum- Dünnschichtverfahren. Im Fokus dieser Arbeit stehen die drei wichtigen keramischen Werkstoffe Aluminiumoxid, Chromoxid und yttriumstabilisiertes Zirkonoxid, die in der Form von wasserbasierten Suspensionen als Spritzzusätze für das Atmosphärische Plasmaspritzen (APS) und das Hochgeschwindigkeitsflammspritzen (HVOF) verwendet werden. Für die Injektion der Suspension in das Plasma oder die Flamme wird ein automatisiertes Suspensionsfördersystem verwendet. Darüber hinaus werden spezielle mehrteilige Injektoren entwickelt und getestet. Es werden neue Erkenntnisse zur statistischen Auswertung der Zusammenhänge zwischen den Injektionsparametern, den messbaren Eigenschaften der Tropfenwolke während der Zerstäubung, den Partikeleigenschaften im Spritzstrahl und den daraus resultierenden Schichteigenschaften vorgestellt. Dafür wurde eine neue Kenngröße für den Beschichtungserfolg, ein sogenannter Beschichtungsfaktor, hergeleitet, der sich mit vergleichsweise geringem Aufwand bestimmen lässt und außerdem die zusätzlichen Prozessvariablen beim Suspensionsspritzen mit berücksichtigt. Im Anschluss werden Beispiele für wasserbasierte, suspensionsgespritzte Schichten aus den drei keramischen Werkstoffen vorgestellt, bei denen durch entsprechende Charakterisierungsmethoden das Anwendungspotential im Vergleich zu Spritzschichten nach dem Stand der Technik verdeutlicht wird. Die Anwendungsgebiete umfassen dabei die elektrische Isolation, den Verschleißschutz sowie die thermische Isolation. Den Abschluss der Arbeit bildet eine kritische Diskussion der Eignung von wasserbasierten Suspensionen für das thermische Spritzen mit Plasma- und Flammspritzprozessen. Es werden die Vor- und Nachteile dieser Beschichtungstechnik analysiert und Verbesserungsvorschläge sowohl für die weitere Suspensions- als auch für die Anlagenentwicklung unterbreitet.

Cold spray is a novel coating method. Due to its low-temperature character, it has a potential to replace the high-temperature thermal spray processes in some applications. The presented work analyzes the microstructure and the phase composition of pure metal coatings deposited by cold spraying and evaluates selected mechanical properties. Specimens prepared by readily used HVOF industrial technology were used for comparison purposes.

Devido à necessidade de obtenção de uma superfície resistente ao desgaste e a oxidação, os cilindros hidráulicos são tradicionalmente revestidos com cromo duro eletrodepositado. Todavia, este tipo de revestimento apresenta uma redução gradual do coeficiente de atrito, interferindo diretamente na lubrificação da haste, ocasionando danos aos elementos de vedação e promovendo consequentes vazamentos. Outro apelo contrário à utilização do processo de revestimento com cromo é a presença, em elevados níveis, de cromo hexavalente Cr+6, apresentando alto poder cancerígeno e de contaminação ambiental. Atualmente, o processo de aspersão térmica em alta velocidade (HVOF - High Velocity Oxi-Fuel) se caracteriza como uma técnica de revestimento alternativa ao cromo duro, utilizando materiais compósitos (metal-cerâmico), os quais propiciam baixas taxas de desgaste. Este trabalho tem como objetivo avaliar o desempenho de revestimentos aplicados em hastes de cilindros hidráulicos revestidas com WC-CoCr pelo processo HVOF, em comparação ao revestimento de cromo duro eletrodepositado. As técnicas de caracterização empregadas foram divididas em duas etapas, sendo que a primeira foi: análise microestrutural, ensaios de dureza e desgaste, medições de rugosidade e perfilometria, em corpos de prova planos e, na segunda etapa, a análise dos revestimentos adquiridos através de uma bancada de testes de hastes de cilindros hidráulicos, onde a caracterização foi obtida através de, medições específicas dos principais parâmetros de rugosidades aplicadas a superfícies de vedação, como Rz, Rmáx e Rmr, desgaste visuais das hastes e vedações e medições de vazamento de óleo. Ao final, os resultados mostram que o revestimento aspergido, indica características competitivas em relação à eletrodeposição de cromo, podendo ser aplicado em hastes de cilindros hidráulicos com algumas vantagens, como por exemplo, maior resistência ao desgaste, menor coeficiente de atrito, menores taxas de vazamento e melhores condições finais de superfícies. / To obtain a surface that is resistant to wear and oxidation, hydraulic cylinders are typically coated with in hard chromium through the process of electroplating process. However, this type of coating displays a gradual reduction of the friction coefficient as the lubrication directly interferes with the shaft mechanism, which in turn causes damage to the sealing elements and promotes subsequent leakage. Another disadvantage in using the electroplated hard chromium process is the presence of high level hexavalent chromium Cr+6 which is not only carcinogenic, but also extremely contaminating to the environment. Currently, the alternative process of high-speed thermal spraying (HVOF - High Velocity Oxy-Fuel), as opposed to hard chrome coating, uses composite materials (metalceramic) possessing low wear rates. This study aims to evaluate and compare the performance of hydraulic cylinder rods coated with WC-CoCr in the HVOF process, and those coated with electroplated hard chromium. The characterization techniques employed were divided into two steps, the first of which was: microstructural analysis, testing the hardness, wear, roughness and profilometry and on specimens plans and, in the second step, analysis of the coating obtained through a bench test rods of hydraulic cylinders, where the characterization was through achieved , specific measurement of the main parameters of roughness applied to sealing surfaces, as Rz, Rmáx and Rmr, wear visual of the rods and seals and measurements of oil leakage. At the end, the results show that the sprayed coating, indicate competitive characteristics in relation to the electrodeposition of chromium, which can be applied in rods of hydraulic cylinders with some advantages, such as improved wear resistance, coefficient friction low, lower rates of leakage and condition final better surface.

Devido à necessidade de obtenção de uma superfície resistente ao desgaste e a oxidação, os cilindros hidráulicos são tradicionalmente revestidos com cromo duro eletrodepositado. Todavia, este tipo de revestimento apresenta uma redução gradual do coeficiente de atrito, interferindo diretamente na lubrificação da haste, ocasionando danos aos elementos de vedação e promovendo consequentes vazamentos. Outro apelo contrário à utilização do processo de revestimento com cromo é a presença, em elevados níveis, de cromo hexavalente Cr+6, apresentando alto poder cancerígeno e de contaminação ambiental. Atualmente, o processo de aspersão térmica em alta velocidade (HVOF - High Velocity Oxi-Fuel) se caracteriza como uma técnica de revestimento alternativa ao cromo duro, utilizando materiais compósitos (metal-cerâmico), os quais propiciam baixas taxas de desgaste. Este trabalho tem como objetivo avaliar o desempenho de revestimentos aplicados em hastes de cilindros hidráulicos revestidas com WC-CoCr pelo processo HVOF, em comparação ao revestimento de cromo duro eletrodepositado. As técnicas de caracterização empregadas foram divididas em duas etapas, sendo que a primeira foi: análise microestrutural, ensaios de dureza e desgaste, medições de rugosidade e perfilometria, em corpos de prova planos e, na segunda etapa, a análise dos revestimentos adquiridos através de uma bancada de testes de hastes de cilindros hidráulicos, onde a caracterização foi obtida através de, medições específicas dos principais parâmetros de rugosidades aplicadas a superfícies de vedação, como Rz, Rmáx e Rmr, desgaste visuais das hastes e vedações e medições de vazamento de óleo. Ao final, os resultados mostram que o revestimento aspergido, indica características competitivas em relação à eletrodeposição de cromo, podendo ser aplicado em hastes de cilindros hidráulicos com algumas vantagens, como por exemplo, maior resistência ao desgaste, menor coeficiente de atrito, menores taxas de vazamento e melhores condições finais de superfícies. / To obtain a surface that is resistant to wear and oxidation, hydraulic cylinders are typically coated with in hard chromium through the process of electroplating process. However, this type of coating displays a gradual reduction of the friction coefficient as the lubrication directly interferes with the shaft mechanism, which in turn causes damage to the sealing elements and promotes subsequent leakage. Another disadvantage in using the electroplated hard chromium process is the presence of high level hexavalent chromium Cr+6 which is not only carcinogenic, but also extremely contaminating to the environment. Currently, the alternative process of high-speed thermal spraying (HVOF - High Velocity Oxy-Fuel), as opposed to hard chrome coating, uses composite materials (metalceramic) possessing low wear rates. This study aims to evaluate and compare the performance of hydraulic cylinder rods coated with WC-CoCr in the HVOF process, and those coated with electroplated hard chromium. The characterization techniques employed were divided into two steps, the first of which was: microstructural analysis, testing the hardness, wear, roughness and profilometry and on specimens plans and, in the second step, analysis of the coating obtained through a bench test rods of hydraulic cylinders, where the characterization was through achieved , specific measurement of the main parameters of roughness applied to sealing surfaces, as Rz, Rmáx and Rmr, wear visual of the rods and seals and measurements of oil leakage. At the end, the results show that the sprayed coating, indicate competitive characteristics in relation to the electrodeposition of chromium, which can be applied in rods of hydraulic cylinders with some advantages, such as improved wear resistance, coefficient friction low, lower rates of leakage and condition final better surface.

Submitted by Celso Diniz (cdiniz.fatec@hotmail.com) on 2018-04-11T18:18:33Z No. of bitstreams: 1 Dissertação- Diniz versão rev 22-FINAL 03-04-2018.pdf: 4564957 bytes, checksum: 4d2c8bf606da87389121421a604f73e2 (MD5) / Approved for entry into archive by Pamella Benevides Gonçalves null (pamella@feg.unesp.br) on 2018-04-12T12:46:53Z (GMT) No. of bitstreams: 1 diniz_c_me_guara.pdf: 4564957 bytes, checksum: 4d2c8bf606da87389121421a604f73e2 (MD5) / Made available in DSpace on 2018-04-12T12:46:53Z (GMT). No. of bitstreams: 1 diniz_c_me_guara.pdf: 4564957 bytes, checksum: 4d2c8bf606da87389121421a604f73e2 (MD5) Previous issue date: 2018-02-21 / Aços inoxidáveis martensíticos, contendo 12-13% de cromo, 2-5% de níquel e menos de 0,06% de carbono, vem sendo utilizados desde a década de 60, por exemplo, na fabricação de equipamentos hidráulicos, tais como turbinas, bombas e propulsores. Aços como o ASTM A743 CA-6NM, temperados e revenidos, passam por processos de tratamento de superfície, visando aumentar a resistência à erosão e corrosão, pois devem, operar sob condições de alta agressividade. Dentre as técnicas utilizadas para revestimento de superfície, a aspersão térmica, HVOF (Hight Velocity Oxigen Fuel), é um processo altamente utilizado, por sua viabilidade técnica e econômica. Atualmente, o aço ASTM A743 CA-6NM com revestimento do tipo WC-10Co-4Cr, com espessura em torno de 100 e 200 µm, é o material mais empregado nos diversos equipamentos hidráulicos, tais como: rotores de bombas, pás de turbinas e hélices navais. O conhecimento das características microestruturais do revestimento e de seu comportamento com relação à corrosão são de grande importância na definição dos parâmetros para a realização da aspersão térmica, gerando economia e qualidade do revestimento. Neste trabalho são realizadas análises por microscopia óptica e microscopia eletrônica de varredura com EDS sobre os revestimento aspergido com WC-10Co-4Cr, visando estudar os parâmetros relacionados à porosidade e composição da microestrutura. Além disso, foram realizadas análises da dureza, ao longo de todo o revestimento, visando estabelecer correlação com as análises obtidas por microscopia, e análise eletroquímica com o intuito de compreender o comportamento do revestimento em meio salino NaCl 3,5% ( mm); todas as imagens adquiridas, passaram por processamento digital. Os resultados demonstraram que os revestimentos obtidos com 6 passes (W6) ou 8 passes (W8) apresentaram baixa porosidade, menor que 2%, sendo que os poros medidos no revestimento W6 apresentaram menor diâmetro de Feret e maior circularidade. A análise com durômetro revelou um comportamento similar dos revestimentos, com valores de dureza praticamente idênticos ao longo da espessura das camadas aspergidas. Os ensaios eletroquímicos, mostraram que o substrato apresentou corrosão puntiforme (pite) após imersão por 5, 20 e 30 h, em solução de NaCl 3,5% (mm), resultado típico para este material. Enquanto os revestimentos W6 e W8, que dentro das especificações dos ensaios, apresentaram comportamentos idênticos, nas análises com circuito aberto e curva de polarização, se mostraram revestimentos com proteção contra a corrosão. / Martensitic stainless steels, containing 12-13% chromium, 2-5% nickel and less than 0.06% carbon, have been used since the 1960s, for example, in the manufacture of hydraulic equipment such as turbines, pumps and propellers. The steels ASTM A 743 CA-6NM, in quenched and tempered conditions, undergo surface treatment processes to increase resistance to erosion and corrosion, once they do operate under conditions of high aggressiveness. Among techniques used for surface coating, thermal spraying, HVOF (Hight Velocity Oxigen Fuel), is a highly utilized process, due to its technical and economical viability. Currently, ASTM A743 CA-6NM steel with WC-10Co-4Cr type coating, with a thickness of 100 m and 200 m, is the most used material in the various pieces of equipment, such as: pump rotors, naval blades and propellers. The knowledge of the microstructural characteristics of the coating and its behavior in relation to corrosion are of great importance, in the definition of the parameters for the realization of the thermal spray, generating economy and quality of the coating. In this paper, optical microscopy and scanning electron microscopy with EDS, on WC-10Co-4Cr sputtering coatings were carried out to study the parameters related to the porosity and microstructure composition. In addition, hardness analyses were performed throughout the coating, to establish correlation with microscopic analysis and electrochemical analysis in order to understand the behavior of the coating in saline solution NaCl 3.5% (wt/wt); all images acquired, passed by digital processing images. The results showed that the coatings obtained with 6 passes (W6) or 8 passes (W8) presented low porosity, less than 2%, and the pores measured in the W6 coating presented smaller Feret diameter and greater circularity. Dilution analysis revealed a similar behavior of the coatings, with hardness values practically identical across the thickness of the sprayed layers. The electrochemical tests showed that the substrate presented punctiform corrosion (pite) after 5, 20 and 30h immersion in NaCl solution 3.5% (wt/wt); result for this material. While the W6 and W8 coatings, which presented identical behavior in the open circuit analysis and polarization curve, within the test specifications, corrosion resistant coatings were found.

Submitted by Automa??o e Estat?stica (sst@bczm.ufrn.br) on 2017-01-12T14:19:58Z No. of bitstreams: 1 AntonioRobertoAugusto_DISSERT.pdf: 15947966 bytes, checksum: 6137cc9dd87967a91d0ea2a7fd5913a0 (MD5) / Approved for entry into archive by Arlan Eloi Leite Silva (eloihistoriador@yahoo.com.br) on 2017-01-17T13:19:05Z (GMT) No. of bitstreams: 1 AntonioRobertoAugusto_DISSERT.pdf: 15947966 bytes, checksum: 6137cc9dd87967a91d0ea2a7fd5913a0 (MD5) / Made available in DSpace on 2017-01-17T13:19:05Z (GMT). No. of bitstreams: 1 AntonioRobertoAugusto_DISSERT.pdf: 15947966 bytes, checksum: 6137cc9dd87967a91d0ea2a7fd5913a0 (MD5) Previous issue date: 2014-09-01 / A lideran?a mundial brasileira na obten??o de etanol derivado da cana de a??car pode ser associada ? produ??o do vinhoto, em uma raz?o de 10 a 18 litros de vinhoto para cada litro de etanol produzido durante o processo de destila??o. Nos cultivos da cana-de-a??car, esse vinhoto tem sido aplicado como adubo org?nico, onde o seu bombeamento ? um elemento cr?tico dessa cadeia produtiva. O objetivo deste trabalho foi investigar os principais mecanismos de desgaste de um rotor e de partes de uma bomba centr?fuga ap?s bombear vinhoto tratado em reator (pH 7,3?0.5). Um filme de 300?75 ?m de metal duro ? base de carboneto de tungst?nio-cobalto (WC-Co) foi aplicado ao rotor de ferro fundido cinzento da bomba atrav?s da t?cnica de aspers?o t?rmica HVOF. Considerando-se os trinta anos de experi?ncia do autor no projeto de sistemas de bombeamento, uma bancada para o bombeamento de vinhoto a 27?2oC foi desenvolvida em Laborat?rio para um servi?o de 1.000 horas atrav?s de ensaios durante dez horas di?rias e cont?nuas de uma bomba modelo INI 32-125 operando sob condi??es de cavita??o, conforme o c?lculo de NPSH. Um sistema de recircula??o do vinhoto foi adotado e controlado por uma v?lvula de descarga empregada comumente em processos industriais. Ap?s os ensaios, tanto o rotor revestido pelo metal duro como algumas partes n?o revestidas da bomba apresentaram um desgaste severo por cavita??o-eros?o, enquanto partes do rotor onde os efeitos da cavita??o s?o menores, o revestimento apresentou um desgaste moderado. / The Brazilian capability concerning to the world's leading producer of sugarcane ethanol can be joined together the vinasse production, which inherent amount discharged by distilling is from 10 to18 liters of vinasse per liter of ethanol produced. This vinasse has been applied in sugar-cane crops as organic fertilizer, where its pumping process is a critical element in this string. The aim of this work was investigate the main wear mechanisms of an impeller and parts of a centrifugal pump after pumping vinasse treated in reactor (pH 8,3?0,7). A tungsten carbide-cobalt (WC10Co4%Cr) film based hard metal of 360?35?m ?m was applied on the grey cast iron pump impeller by HVOF thermal aspersion. Based on the 30 years of experience of the author in the design and mounting of pumping systems, a test rig was developed in Laboratory for 1,000 hours of pumping tests of vinasse at 27?2oC for a continuous service during 10 hours by day for a pump model 32-125, working under cavitation conditions through the calculation of Net Positive Suction Head (NPSH), A recirculating system of the vinasse was adopted and controlled by a discharge valve usually employed in the industrial processes. After the tests, both the coated rotor as the uncoated parts of the pump showed severe wear by cavitation-erosion, while parts of the rotor where the effects of cavitation are smaller, the coating showed a moderate wear.