41 |
Ganzheitliche Verfahrens- und Schichtoptimierung für das HochgeschwindigkeitsdrahtflammspritzenRupprecht, Christian 16 March 2009 (has links)
Das Ziel der Dissertation ist die Charakterisierung und Optimierung der Prozessbedingungen beim Hochgeschwindigkeitsdrahtflammspritzen. Dazu werden diagnostische Methoden wie das LDA-Verfahren, die Bewertung von Schichten und numerische Betrachtungen herangezogen. Verschiedene Spritzzusatzwerkstoffe wie Massiv- und Fülldrähte sowie hoch- und niedrigschmelzende Materialien werden verarbeitet. Zur Bewertung der Gebrauchseigenschaften erfolgen Korrosions- und Verschleißtests. Aus den Untersuchungsergebnissen resultieren Hinweise und Konzepte zur Verbesserung der Brennertechnik. Die Entwicklung eines neuen HVCW-Systems wird vorgestellt, welches Spritzpartikelgeschwindigkeiten im Überschallbereich ermöglicht, die deutlich über denen klassischer Systeme liegen. In einem gesonderten Abschnitt der Dissertation wird ein neuartiges Verfahren zur Herstellung hydrolysefähigen Materials vorgestellt. Der hergestellte Al-Sn-Werkstoff zersetzt sich in Kontakt mit Wasser unter Abgabe großer Mengen Wasserstoff in kürzester Zeit vollständig.
|
42 |
Stanovení vlastností původních a EB-modifikovaných nástřiků deponovaných technologiemi tepelného nanášení pomocí vrypové zkoušky a testování nano-indentací / Determination of properties of as-sprayed and EB-deposited coatings prepared by thermal spray technologies using scratch test and nano-indentation methodsCének, Lukáš January 2014 (has links)
Properties of samples and their coatings may be affected by the electron beam. This paper deals with the analysis of the microstructure, phase and chemical composition and the determination of mechanical characteristics of inconel steel substrate and CoNiCrAlY coatings deposited via different types of thermal spraying (HVOF, cold spray), in combination with modifications by the electron beam technology. During the study it was found that the deposition did not change the chemical composition. Further it was found that the interaction of the electron beam with the material did not change the chemical composition, but there is a change in the structure and a reduction of porosity and surface roughness, resulting in a change of mechanical properties such as decreasing hardness or increase of the modulus of elasticity.
|
43 |
Aging of FeCrAl Surface CoatingsAlsaifi, Fadi January 2019 (has links)
This Thesis is about the aging of FECRAL surface coatings. In this thesis various substrates have been investigated such as 16 Mo3, 304, 347, Sanicro 31, 800HT, Nikrothal 80 and Kanthal APMT. These substrates have been coated with different FeCrAl alloys, using two different coating methods spraying with (High Velocity Air Force) and welding with (Metal Inert Gas). The purpose of coating is to achieve specific properties of the layer without affecting the original properties of the substrate. Therefore, it is important to investigate the boundary layer between these two different materials to observe how the interdiffusion of different substances such as Cr, Al, Fe and C is affected, which is the purpose of this project. The method used to investigate this purpose was to expose these combinations in different temperatures and in different environments for different time intervals. Then, using LOM, SEM and EDS analysis, the change that the boundary layers have undergone is examined. Some calculations in DICTRA have also been performed to see if it was possible to find any connection between experimental data and simulation results. The result showed carburization of FeCrAl-coatings on 16Mo3 substrates which can lead to deterioration of mechanical properties in the substrates but also decreased corrosion resistance for the coated layers. The result has also shown that it is difficult to perform spraying for small cylindrical products. The reason for this may be the high powder dispersion and the expansion of certain products when spraying, which causes the layer to loosen due to the shrinkage followed by cooling. APMT sprayed with Nikrothal 80 has shown high porosity in the substrates and high interdiffusion of Fe and Ni. High Ni diffusion in low Al alloys such as K 198 may be a reason why the coated layer cannot optimally form the protective oxide. / Detta projekt handlar om åldring av FECRAL ytbeläggningar. I den här avhandlingen så har olika substrat blivit undersökta såsom 16Mo3, 304, 347, Sanicro 31, 800HT, Nikrothal 80 och Kanthal APMT. Dessa substrat har blivit belagda med olika FeCrAl legeringar, med hjälp av två olika beläggningsmetoder, påsprutning (High Velocity Air Force) och påsvetsning (Metal Inert Gas). Syftet med att materialet beläggs är att uppnå specifika egenskaper utan att påverka substratens ursprungliga egenskaper. Det är därför viktigt att undersöka gränsskiktet mellan dessa två olika material för att se hur interdiffusionen av olika element såsom Cr, Al, Fe och C påverkas av värmebehandling. Metoden som användes för att undersöka detta var att exponera dessa kombinationer i olika temperaturer och i olika miljöer för olika tidsintervall. Därefter med hjälp av LOM, SEM och EDS analys undersöktes förändringen som gränsskikten har genomgått. Några beräkningar i DICTRA har även utförts för att se om det var möjligt att hitta någon koppling mellan experimentella data och simuleringsresultatet. Resultaten visade att 16Mo3 kombinationer fått en tydlig hög uppkolning i skiktet vilket kan påverka mekaniska egenskaperna och korrosionbeständigheten under användning vid höga temperaturer. Resultatet har även visat att det är svårt att utföra påsprutning för små cylindriska produkter. Anledningen till detta kan vara hög pulverspridningen samt den termiska expansionen av vissa produkter vid påsprutning som leder till att skiktet kan lossna på grund av krympningen vid svalning. APMT påsprutad med Nikrothal 80 har visat hög porositet i substraten och hög interdiffusion av Fe, Al och Ni under exponering vid 1200°C. Hög uppblandning och diffusion av nickel för det FECRAL belagda skiktet med relativt låg halt av aluminium K 198 kan vara en anledning till att belagda skiktet inte kan forma en skyddande oxid på ett optimalt sätt.
|
44 |
Effect of Adjusted Gas Nitriding Parameters on Microstructure and Wear Resistance of HVOF-Sprayed AISI 316L CoatingsKutschmann, Pia, Lindner, Thomas, Börner, Kristian, Reese, Ulrich, Lampke, Thomas 31 July 2019 (has links)
Gas nitriding is known as a convenient process to improve the wear resistance of steel components. A precipitation-free hardening by low-temperature processes is established to retain the good corrosion resistance of stainless steel. In cases of thermal spray coatings, the interstitial solvation is achieved without an additional surface activation step. The open porosity permits the penetration of the donator media and leads to a structural diffusion. An inhomogeneous diffusion enrichment occurs at the single spray particle edges within the coating’s microstructure. A decreasing diffusion depth is found with increasing surface distance. The present study investigates an adjusted process management for low-temperature gas nitriding of high velocity oxy-fuel-sprayed AISI 316L coatings. To maintain a homogeneous diffusion depth within the coating, a pressure modulation during the process is studied. Additionally, the use of cracked gas as donator is examined. The process management is designed without an additional surface activation step. Regardless of surface distance, microstructural investigations reveal a homogeneous diffusion depth by a reduced processing time. The constant hardening depth allows a reliable prediction of the coatings’ properties. An enhanced hardness and improved wear resistance is found in comparison with the as-sprayed coating condition.
|
45 |
Development of Cold Gas Dynamic Spray Nozzle and Comparison of Oxidation Performance of Bond Coats for Aerospace Thermal Barrier Coatings at Temperatures of 1000°C and 1100°CRoy, Jean-Michel L. 08 February 2012 (has links)
The purpose of this research work was to develop a nozzle capable of depositing dense CoNiCrAlY coatings via cold gas dynamic spray (CGDS) as well as compare the oxidation performance of bond coats manufactured by CGDS, high-velocity oxy-fuel (HVOF) and air plasma spray (APS) at temperatures of 1000°C and 1100°C. The work was divided in two sections, the design and manufacturing of a CGDS nozzle with an optimal profile for the deposition of CoNiCrAlY powders and the comparison of the oxidation performance of CoNiCrAlY bond coats. Throughout this work, it was shown that the quality of coatings deposited via CGDS can be increased by the use of a nozzle of optimal profile and that early formation of protective α-Al2O3 due to an oxidation temperature of 1100°C as opposed to 1000°C is beneficial to the overall oxidation performance of CoNiCrAlY coatings.
|
46 |
Development of Cold Gas Dynamic Spray Nozzle and Comparison of Oxidation Performance of Bond Coats for Aerospace Thermal Barrier Coatings at Temperatures of 1000°C and 1100°CRoy, Jean-Michel L. 08 February 2012 (has links)
The purpose of this research work was to develop a nozzle capable of depositing dense CoNiCrAlY coatings via cold gas dynamic spray (CGDS) as well as compare the oxidation performance of bond coats manufactured by CGDS, high-velocity oxy-fuel (HVOF) and air plasma spray (APS) at temperatures of 1000°C and 1100°C. The work was divided in two sections, the design and manufacturing of a CGDS nozzle with an optimal profile for the deposition of CoNiCrAlY powders and the comparison of the oxidation performance of CoNiCrAlY bond coats. Throughout this work, it was shown that the quality of coatings deposited via CGDS can be increased by the use of a nozzle of optimal profile and that early formation of protective α-Al2O3 due to an oxidation temperature of 1100°C as opposed to 1000°C is beneficial to the overall oxidation performance of CoNiCrAlY coatings.
|
47 |
Development of Cold Gas Dynamic Spray Nozzle and Comparison of Oxidation Performance of Bond Coats for Aerospace Thermal Barrier Coatings at Temperatures of 1000°C and 1100°CRoy, Jean-Michel L. 08 February 2012 (has links)
The purpose of this research work was to develop a nozzle capable of depositing dense CoNiCrAlY coatings via cold gas dynamic spray (CGDS) as well as compare the oxidation performance of bond coats manufactured by CGDS, high-velocity oxy-fuel (HVOF) and air plasma spray (APS) at temperatures of 1000°C and 1100°C. The work was divided in two sections, the design and manufacturing of a CGDS nozzle with an optimal profile for the deposition of CoNiCrAlY powders and the comparison of the oxidation performance of CoNiCrAlY bond coats. Throughout this work, it was shown that the quality of coatings deposited via CGDS can be increased by the use of a nozzle of optimal profile and that early formation of protective α-Al2O3 due to an oxidation temperature of 1100°C as opposed to 1000°C is beneficial to the overall oxidation performance of CoNiCrAlY coatings.
|
48 |
Microstructure and Wear Resistance of AlCoCrFeNiTi High-Entropy Alloy Coatings Produced by HVOFLöbel, Martin, Lindner, Thomas, Mehner, Thomas, Lampke, Thomas 30 October 2017 (has links) (PDF)
The investigation of high-entropy alloys (HEAs) has revealed many promising properties. HEAs with a high share of Al and Ti are suitable for the formation of lightweight materials. Investigations of the alloy system AlCoCrFeNiTi showed high strength, hardness, ductility, and wear resistance, which makes this special alloy interesting for surface engineering and particularly for thermal spray technology. In this study, the suitability of inert gas-atomised HEA powder for high-velocity-oxygen-fuel (HVOF) thermal spray is investigated. This process allows for high particle velocities and comparatively low process temperatures, resulting in dense coatings with a low oxidation. The microstructure and phase composition of the atomised powder and the HVOF coating were investigated, as well as the wear behaviour under various conditions. A multiphase microstructure was revealed for the powder and coating, whereas a chemically ordered bcc phase occurred as the main phase. The thermal spray process resulted in a slightly changed lattice parameter of the main phase and an additional phase. In comparison with a hard chrome-plated sample, an increase in wear resistance was achieved. Furthermore, no brittle behaviour occurred under abrasive load in the scratch test. The investigation of wear tracks showed only minor cracking and spallation under maximum load.
|
49 |
Development of Cold Gas Dynamic Spray Nozzle and Comparison of Oxidation Performance of Bond Coats for Aerospace Thermal Barrier Coatings at Temperatures of 1000°C and 1100°CRoy, Jean-Michel L. January 2012 (has links)
The purpose of this research work was to develop a nozzle capable of depositing dense CoNiCrAlY coatings via cold gas dynamic spray (CGDS) as well as compare the oxidation performance of bond coats manufactured by CGDS, high-velocity oxy-fuel (HVOF) and air plasma spray (APS) at temperatures of 1000°C and 1100°C. The work was divided in two sections, the design and manufacturing of a CGDS nozzle with an optimal profile for the deposition of CoNiCrAlY powders and the comparison of the oxidation performance of CoNiCrAlY bond coats. Throughout this work, it was shown that the quality of coatings deposited via CGDS can be increased by the use of a nozzle of optimal profile and that early formation of protective α-Al2O3 due to an oxidation temperature of 1100°C as opposed to 1000°C is beneficial to the overall oxidation performance of CoNiCrAlY coatings.
|
50 |
Struktura a vlastnosti tepelných bariér typu YSZ nanesených na krycí vrstvy CoNiCrAlY přetavené elektronovým paprskem / Microstructure and properties of YSZ thermal barier coatings deposited onto CoNiCrAlY bond coats remelted by electron beamSlavíková, Barbora January 2019 (has links)
The master thesis is dealing with characterization of the structure and properties of the YSZ thermal barrier coating deposited by water hybrid plasma spray technology on the CoNiCrAlY bond coats modified by using electron beam and vacuum annealing. Deposition of the bond coats was performed via high velocity oxy-fuel technology and cold spray. In case of experimental evaluation, the microstructure and chemical composition of the ceramic top coat deposited with powder and suspension feedstock was analyzed. The same analysis procedure was used also for bond coats after electron beam remelting by using two sets of parameters. Furthermore, the changes in microstructure and chemical composition of the remelted and annealed bond coats was evaluated. Eventually, the micromechanical properties of the top coats and the bond coats were measured. The ceramic top coats deposited with powder feedstock exhibited the structure composed by splats, while the top coats deposited in form of suspension showed fine structure with columnar grains. The dendritic structure was observed on remelted bond coats. The annealing process had an influence on the structure in form of coarsened phases and the chemical composition was changed due to diffusion of the elements.
|
Page generated in 0.0158 seconds