Devido à necessidade de obtenção de uma superfície resistente ao desgaste e a oxidação, os cilindros hidráulicos são tradicionalmente revestidos com cromo duro eletrodepositado. Todavia, este tipo de revestimento apresenta uma redução gradual do coeficiente de atrito, interferindo diretamente na lubrificação da haste, ocasionando danos aos elementos de vedação e promovendo consequentes vazamentos. Outro apelo contrário à utilização do processo de revestimento com cromo é a presença, em elevados níveis, de cromo hexavalente Cr+6, apresentando alto poder cancerígeno e de contaminação ambiental. Atualmente, o processo de aspersão térmica em alta velocidade (HVOF - High Velocity Oxi-Fuel) se caracteriza como uma técnica de revestimento alternativa ao cromo duro, utilizando materiais compósitos (metal-cerâmico), os quais propiciam baixas taxas de desgaste. Este trabalho tem como objetivo avaliar o desempenho de revestimentos aplicados em hastes de cilindros hidráulicos revestidas com WC-CoCr pelo processo HVOF, em comparação ao revestimento de cromo duro eletrodepositado. As técnicas de caracterização empregadas foram divididas em duas etapas, sendo que a primeira foi: análise microestrutural, ensaios de dureza e desgaste, medições de rugosidade e perfilometria, em corpos de prova planos e, na segunda etapa, a análise dos revestimentos adquiridos através de uma bancada de testes de hastes de cilindros hidráulicos, onde a caracterização foi obtida através de, medições específicas dos principais parâmetros de rugosidades aplicadas a superfícies de vedação, como Rz, Rmáx e Rmr, desgaste visuais das hastes e vedações e medições de vazamento de óleo. Ao final, os resultados mostram que o revestimento aspergido, indica características competitivas em relação à eletrodeposição de cromo, podendo ser aplicado em hastes de cilindros hidráulicos com algumas vantagens, como por exemplo, maior resistência ao desgaste, menor coeficiente de atrito, menores taxas de vazamento e melhores condições finais de superfícies. / To obtain a surface that is resistant to wear and oxidation, hydraulic cylinders are typically coated with in hard chromium through the process of electroplating process. However, this type of coating displays a gradual reduction of the friction coefficient as the lubrication directly interferes with the shaft mechanism, which in turn causes damage to the sealing elements and promotes subsequent leakage. Another disadvantage in using the electroplated hard chromium process is the presence of high level hexavalent chromium Cr+6 which is not only carcinogenic, but also extremely contaminating to the environment. Currently, the alternative process of high-speed thermal spraying (HVOF - High Velocity Oxy-Fuel), as opposed to hard chrome coating, uses composite materials (metalceramic) possessing low wear rates. This study aims to evaluate and compare the performance of hydraulic cylinder rods coated with WC-CoCr in the HVOF process, and those coated with electroplated hard chromium. The characterization techniques employed were divided into two steps, the first of which was: microstructural analysis, testing the hardness, wear, roughness and profilometry and on specimens plans and, in the second step, analysis of the coating obtained through a bench test rods of hydraulic cylinders, where the characterization was through achieved , specific measurement of the main parameters of roughness applied to sealing surfaces, as Rz, Rmáx and Rmr, wear visual of the rods and seals and measurements of oil leakage. At the end, the results show that the sprayed coating, indicate competitive characteristics in relation to the electrodeposition of chromium, which can be applied in rods of hydraulic cylinders with some advantages, such as improved wear resistance, coefficient friction low, lower rates of leakage and condition final better surface.

Für die Entwicklung neuer Technologien wird mehr und mehr der Einsatz von Spritzschichten benötigt. Hiermit lassen sich die komplexen Anforderungen an die Oberflächeneigenschaften erfüllen. Die thermischen Spritzverfahren werden immer mehr auch zum Mittelpunkt von Industrieanwendungen und bieten ein großes Anwendungsgebiet. Die Steigerung der Produktivität und der Leistung von technischen Anlagen und Maschinen erhöht gleichzeitig auch die Beanspruchung der Bauteile. Daher ist es notwendig, dass hochbeanspruchte oder gefährdete Oberflächen durch thermisches Spritzen geschützt werden, so dass sie den Belastungen besser standhalten. Ebenso führt die allgemeine Rohstoffknappheit dazu, dass Maschinenteile nicht vollständig aus bestimmten Materialien gefertigt werden können. Diese Teile können durch eine geeignete Oberflächenbeschichtung rohstoffsparend und damit kostengünstig hergestellt werden. Ein weiteres Anwendungsgebiet für das thermische Spritzen ist die Reparatur verschlissener Teile. Die hohe Flexibilität des thermischen Spritzens, die geringen Reparaturkosten und die damit verbundenen kurzen Ausfallzeiten kommen der Industrie zu Gute. Nach wie vor existiert keine Online-Prozesskontrolle, welche die relevanten Größen der Wechselwirkung Flamme – Spritzzusatzwerkstoff erfassen kann. Die Schichtoptimierung erfolgt weitestgehend durch eine empirische Veränderung der Spritzparameter und die anschließende Analyse und Zuordnung der Parameter zu den Ergebnissen. Hierbei beschränkt sich die Prozesskontrolle auf das Einstellen konstanter Werte für die regelbaren Eingangsgrößen. Bei diesen Möglichkeiten wird vorausgesetzt, dass bei konstanten Maschineneinstellungen auch ein konstanter Prozess mit reproduzierbaren Ergebnissen vorliegt. Im täglichen Umgang ist jedoch festzustellen, dass die Ergebnisse über einen längeren Zeitraum meist nicht reproduzierbar sind. Eine online arbeitende Meßmethode, die Aussagen über die Geschwindigkeit und Erwärmung der Spritzpartikel macht, liefert die Grundlage für reproduzierbare Ergebnisse. An Stelle der Anlagensteuergrößen werden Partikelparameterkorrelierte Messgrößen überwacht bzw. für eine Steuerung verwendet. Der Zugang zu Flammen- bzw. Partikeltemperatur erfolgt mit Hilfe der optischen Emissionsspektroskopie. In der vorliegenden Arbeit wird das Emissionsspektrum an zwei Orten entlang der Plasmaachse ausgewertet. Aus dem Intensitätsverhältnis von mehreren Spektrallinien eines Elements wird die Temperaturentwicklung der Partikel ermittelt (Temperaturbestimmung an mehreren Orten) und damit auch deren Geschwindigkeit beurteilt. Kenntnisse über die Temperatur- und Geschwindigkeitsverteilung geben die Möglichkeit reproduzierbare Schichten herzustellen, da die Bedingungen zu einem späteren Zeitpunkt exakt reproduziert werden können. Durch fluiddynamische Rechnungen wird der Nachweis erbracht, dass die Temperatur- und Geschwindigkeitsfelder des Plasmas und der injizierten Partikel miteinander korreliert sind. Im Verlauf dieser Arbeit wird weiterhin gezeigt, dass die genannten Messgrößen eine Signifikanz zum Spritzprozess aufweisen. Mögliche Störeinflüsse sowie eine Fehlerbetrachtung ergänzen die gewonnen Aussagen.

Schichten auf Basis von Molybdändisilizid werden mittels Hochgeschwindigkeitsflammspritzens an Stelle der heute gebräuchlichen Plasmaspritzverfahren erzeugt. Für die Herstellung der Spritzpulver kommen die Hochenergiemahlung und anschließend das drucklose Sintern zum Einsatz. Zur gezielten Einstellung der Schichtporosität werden relevante Prozessparameter mit Hilfe der statistischen Versuchsplanung ermittelt. Anschließend erfolgt die Abscheidung von MoSi2-Schichten mit unterschiedlichen Porositätsniveaus. Als für die Nutzung von Molybdändisilizidschichten im Hochtemperaturbereich relevanteste Systemeigenschaft wird das Oxidationsverhalten bei unterschiedlichen Temperaturen im Bereich von 500 °C bis 1500 °C untersucht. Dafür kommen thermogravimetrische Methoden, Temperaturwechselfestigkeits- und Thermoschockversuche zur Anwendung. Ein Praxistest in einer Hausmüllverbrennungsanlage prüft die Korrosionsbeständigkeit der MoSi2-Beschichtungen in einer möglichen Anwendung. Zusätzlich zur Analyse der Schichtgefüge mit licht- und elektronenmikroskopischen Verfahren, Röntgenfeinstrukturanalyse und Sauerstoffgehaltsmessungen werden die mechanischen Kennwerte Oberflächenrauheit und Mikrohärte bestimmt. Die Untersuchungsergebnisse weisen nach, dass hochgeschwindigkeitsflammgespritzte Molybdändisilizidschichten nach entsprechender Gefügeoptimierung im Temperaturbereich von 500 °C bis 1500 °C, vor allem bei Temperaturen oberhalb von 1200 °C, als Oxidationsschutzschichten empfohlen werden können.

Die Habilitation befasst sich mit neuen Verfahren und Anwendungen des Thermischen Spritzens, beleuchtet anhand einer internationalen Umfrage den Forschungsbedarf der Branche und liefert zahlreiche Lösungen, die im Rahmen von grundlagenorientierten und industrienahen Forschungsvorhaben erarbeitet wurden. Der Fokus der Arbeit liegt auf der Verbesserung individueller Arbeitsschritte der Prozesskette des Thermischen Spritzens, wobei Ergebnisse aus den Bereichen Werkstoffentwicklung, Prozessoptimierung, Qualitätssicherung und Nachbearbeitung zusammengeführt und durch konkrete Anwendungsbeispiele hinterlegt werden. Im Detail werden die Aspekte Herstellung leistungsfähiger und preiswerter Spritzzusätze (Wasserverdüsung von Metallpulvern, Hochenergiekugelmahlen, Agglomerieren und Sintern sowie Fülldrahtherstellung), die Verbesserung der Prozessführung (numerisch optimierte Spritzbrenner und automatisierbare Online-Prozessdiagnostikmethoden) und die Steigerung der Leistungsfähigkeit der Beschichtungen durch mechanische Nachbearbeitung sowie Versieglung behandelt. Anwendungsbezogen werden das Beschichten von Hochleistungspolymeren und CFC-Leichtbaustrukturen untersucht. Um Anknüpfungspunkte für weiterführende Forschungsarbeiten zu schaffen, schließt die Arbeit mit der Darstellung von Entwicklungstrends und zeigt Arbeitsgebiete auf, die perspektivisch von thermisch gespritzten Schichten profitieren können.

Die Habilitation befasst sich mit neuen Verfahren und Anwendungen des Thermischen Spritzens, beleuchtet anhand einer internationalen Umfrage den Forschungsbedarf der Branche und liefert zahlreiche Lösungen, die im Rahmen von grundlagenorientierten und industrienahen Forschungsvorhaben erarbeitet wurden. Der Fokus der Arbeit liegt auf der Verbesserung individueller Arbeitsschritte der Prozesskette des Thermischen Spritzens, wobei Ergebnisse aus den Bereichen Werkstoffentwicklung, Prozessoptimierung, Qualitätssicherung und Nachbearbeitung zusammengeführt und durch konkrete Anwendungsbeispiele hinterlegt werden. Im Detail werden die Aspekte Herstellung leistungsfähiger und preiswerter Spritzzusätze (Wasserverdüsung von Metallpulvern, Hochenergiekugelmahlen, Agglomerieren und Sintern sowie Fülldrahtherstellung), die Verbesserung der Prozessführung (numerisch optimierte Spritzbrenner und automatisierbare Online-Prozessdiagnostikmethoden) und die Steigerung der Leistungsfähigkeit der Beschichtungen durch mechanische Nachbearbeitung sowie Versieglung behandelt. Anwendungsbezogen werden das Beschichten von Hochleistungspolymeren und CFC-Leichtbaustrukturen untersucht. Um Anknüpfungspunkte für weiterführende Forschungsarbeiten zu schaffen, schließt die Arbeit mit der Darstellung von Entwicklungstrends und zeigt Arbeitsgebiete auf, die perspektivisch von thermisch gespritzten Schichten profitieren können.

La réalisation de revêtements projetés de haute qualité passe par une bonne cohésion du dépôt et une adhérence élevée des revêtements sur leur substrat. Du fait de leur mode d'élaboration, les microstructures des interfaces dépôt/substrat et particule/particule obtenues par projection thermique sont complexes et les propriétés en dépendant hétérogènes. Afin d'optimiser l'adhérence des revêtements, il est nécessaire d'établir des relations entre microstructure et résistance de ces interfaces. C'est l'objet de cette étude. Le système modèle cuivre projeté sur aluminium a été retenu non seulement pour son fort potentiel industriel mais également pour la grande réactivité métallurgique du couple (Al, Cu). Des interfaces présentant des propriétés métallurgiques variées ont ainsi pu être obtenues, en jouant sur les procédés et conditions de projection. Ces interfaces ont été analysées à des échelles fines. Des caractérisations quantitatives des propriétés métallurgiques et morphologiques de ces interfaces ont aussi été réalisées. Un essai d'adhérence original, utilisant le phénomène de choc laser, a été développé pour déterminer l'adhérence de revêtements épais (quelques centaines de microns) correspondant à ces interfaces. L'essai LASAT (pour LASer Adhérence Test) s'est avéré particulièrement sensible aux propriétés des interfaces et approprié à leur étude locale. L'association des analyses fines et quantitatives des interfaces avec l'évaluation de leur résistance par l'essai de choc laser a permis d'identifier les principaux mécanismes d'adhérence responsables de la bonne tenue des revêtements de Cu sur Al et/ou des particules de Cu sur celles déjà déposées, dans le cas de projections plasma, HVOF et cold spray. L'influence de la propreté et de la morphologie des interfaces sur l'adhérence des dépôts projetés a été, en particulier, étudiée. Enfin, des outils de simulation ont permis de reproduire les phénomènes intervenant aux interfaces obtenues par projection thermique et ainsi de préciser les modes de formation des liaisons interfaciales.

Na indústria hidrometalúrgica, diversos materiais são utilizados para a construção dos equipamentos, a fim de satisfazer as necessidades dos processos que estão sujeitos, tendo em conta a importância deles em condições complexas, tais como erosão e a corrosão. Neste trabalho é avaliado o comportamento de um aço inoxidável martensítico AISI 410 tratado termicamente com têmpera e revenimento, frente aos revestimentos Carbeto de Tungstênio (86WC-10Co4Cr) obtido por aspersão térmica (High Velocity Oxygen Fuel-HVOF), e um elastômero PUR comercial MetaLine 785 em condições de desgaste do tipo lama, analisando a perda de volume, a determinação da área e profundidade erodida das amostras, para os ângulos de incidência de 30∘ e 90∘ entre o eixo de simetria do fluxo do fluido e a superfície das amostras. Os ensaios foram realizados para os diferentes tipos de materiais em um equipamento para ensaios simulados de lama, desenvolvido como parte da pesquisa no LACER (Laboratório de Materiais Cerâmicos) da Universidade Federal do Rio Grande do Sul (UFRGS), sob controle de parâmetros como ângulo de impacto e sua velocidade, temperatura de ensaio e concentração de partículas erosivas na suspensão, neste caso foi usada alumina eletrofundida ALO marrom da companhia Treibacher. Realizou-se a caracterização dos materiais, na sua microestrutura Microscopia Eletrônica de Varredura (MEV), Microscopia Óptica (M.O), espessura, rugosidade, porosidade, microdureza e estruturalmente na identificação de fases Difração de Raios X (DRX), Espectroscopia por Energia Dispersiva (EDS), o analise térmico Perda ao Fogo (LOI) para o caso do elastômero PUR, e a distribuição de tamanho de partícula (LG) e morfologia para o erodente. Com a pesquisa conseguiu-se estabelecer as relações entre o desgaste erosivo por lama e as propriedades físicas relacionadas aos materiais avaliados, nas condições estabelecidas no ensaio de erosão do equipamento, e concluiu-se que o revestimento de 86WC-10Co4Cr carbeto de Tungstênio apresentou uma melhor resistência ao desgaste erosivo tipo lama, em comparação com o aço inoxidável martensítico AISI 410 e o elastômero PUR comercial MetaLine 785. / In the hydrometallurgical industry, many materials are used in the construction of the equipment in order to satisfy the needs of the processes to which they are subjected, taking into account their importance in complex conditions such as erosion and corrosion. In this work, the behavior of a quenched and tempered AISI 410 martensitic stainless steel is compared to tungsten carbide (86WC-10Co4Cr) obtained by thermal spray (High Velocity Oxygen Fuel - HVOF) and to a commercial elastomer PUR MetaLine 785 under slurry erosion conditions. Volume loss, area determination and eroded depth of the samples were analyzed at angles of incidence of 30∘ and 90∘ between the axis of symmetry of the fluid flow and the surface of the samples. The tests were carried out for the different types of materials in a slurry erosion simulation device, developed as part of the research in LACER (Laboratory of Ceramic Materials) of the Federal University of Rio Grande do Sul (UFRGS), via the control of parameters such as angle and speed of impact, test temperature and concentration of erosive particles in the suspension. In this case, electrofused brown ALO alumina (Treibacher) was used. The materials were characterized with regard to their microstructure (SEM), thickness, roughness, porosity, microhardness, structure in the phase identification (DRX) (EDS), thermal analysis (LOI) in the case of the PUR elastomer and the particle size distribution (LG) and morphology for the erodent. The research was able to establish the relationships between the slurry erosive wear and the physical properties related to the evaluated materials, under the conditions established in the erosion test of the equipment. It was concluded that the coating 86WC-10Co4Cr tungsten carbide presented better resistance to the slurry erosion wear when compared to AISI 410 martensitic stainless steel and the PUR commercial elastomer MetaLine 785.

O desgaste é um dos fatores que causam a maior parte das falhas e redução na vida útil de ferramentas, além de resultar em produtos com condições superficiais inadequadas. A crescente demanda da indústria por menores custos, maior produtividade e melhor qualidade estão entre as justificativas para que se busquem maneiras de incrementar o desempenho dessas ferramentas. Neste contexto, o trabalho tem como objetivo avaliar e caracterizar superfícies projetadas para resistência ao desgaste utilizando o processo de aspersão térmica oxicombustível de alta velocidade (HVOF). Fez-se um estudo comparativo de caracterização e comportamento tribológico de um aço ferramenta com deposição por aspersão térmica de dois diferentes revestimentos. O estudo abrange o aço ABNT H13, utilizando o tratamento superficial de aspersão térmica HVOF com revestimentos de Cr3C2-25(NiCr) e WC-10Co-4Cr. A avaliação da superfície e do comportamento tribológico envolveu perfis de microdureza, análise de fases por difração de raios X, metalografias, obtenção da composição química, caracterização da rugosidade, ensaio de abrasão e adesão, pino-disco e ensaio do anel. O objetivo de conseguir aumentar a resistência ao desgaste utilizando um aço ferramenta com deposição via processo de HVOF, bem como o de caracterizar este processo foi alcançado. A utilização do aço ABNT H13 com deposição via aspersão térmica HVOF e revestimentos à base de carboneto de cromo e tungstênio demonstrou-se recomendável para proteção de substratos, fornecendo alta dureza e boa resistência ao desgaste. O revestimento de WC-10Co-4Cr obteve o melhor desempenho geral, apresentando uma microdureza 192% maior frente ao aço sem revestimento, uma redução de 315% do coeficiente de atrito, além de uma adesão maior ao substrato quando comparado com o revestimento Cr3C2-25(NiCr). / Wear is one of the factors that cause most of the failures and reduction of lifespan for tools, it also results in products with no quality in the surface conditions. The increasing demand of the industry for lower costs, higher productivity and better quality are among the justifications for finding ways to increase the performance of these tools. In this context, the objective of this work is to evaluate and characterize surfaces designed for wear resistance using the high velocity oxyfuel (HVOF) thermal spray process. A comparative study of characterization and tribological behavior of a tool steel with thermal spray deposition was performed for two different coatings. The study covers the ABNT H13 steel, using the surface treatment of HVOF thermal spray with coatings of Cr3C2-25(NiCr) and WC-10Co-4Cr. The surface and the tribological behavior evaluation involved microhardness profiles, phase analysis by x-ray diffraction, metallography, chemical composition, roughness characterization, abrasion and adhesion test, pin-on-disk and ring test. The objective of increasing the wear resistance using a tool steel with deposition through HVOF process, as well as to characterize this process was achieved. The use of ABNT H13 steel with chrome and tungsten carbide coatings deposited by thermal spray HVOF has proved to be recommended for substrates protection, providing high hardness and good wear resistance. The WC-10Co-4Crcoating had the best overall performance, presenting a microhardness 192% higher than the steel with no coating, a reduction of 315% of the coefficient of friction, and a higher adhesion to the substrate compared to the Cr3C2-25(NiCr) coating.

Das Ziel der Dissertation ist die Charakterisierung und Optimierung der Prozessbedingungen beim Hochgeschwindigkeitsdrahtflammspritzen. Dazu werden diagnostische Methoden wie das LDA-Verfahren, die Bewertung von Schichten und numerische Betrachtungen herangezogen. Verschiedene Spritzzusatzwerkstoffe wie Massiv- und Fülldrähte sowie hoch- und niedrigschmelzende Materialien werden verarbeitet. Zur Bewertung der Gebrauchseigenschaften erfolgen Korrosions- und Verschleißtests. Aus den Untersuchungsergebnissen resultieren Hinweise und Konzepte zur Verbesserung der Brennertechnik. Die Entwicklung eines neuen HVCW-Systems wird vorgestellt, welches Spritzpartikelgeschwindigkeiten im Überschallbereich ermöglicht, die deutlich über denen klassischer Systeme liegen. In einem gesonderten Abschnitt der Dissertation wird ein neuartiges Verfahren zur Herstellung hydrolysefähigen Materials vorgestellt. Der hergestellte Al-Sn-Werkstoff zersetzt sich in Kontakt mit Wasser unter Abgabe großer Mengen Wasserstoff in kürzester Zeit vollständig.

A aspersão térmica por chama hipersônica tem se destacado pelo método rápido e eficiente para aplicação de revestimentos com grandes vantagens como: tempo, custo e qualidade. Os revestimentos de Inconel 625 apresentam uma série de aplicações industriais principalmente nos segmentos industriais: químico e petroquímico. Neste contexto, o presente trabalho tem por objetivo avaliar as tensões residuais em revestimentos de Inconel 625 obtidos por aspersão térmica de chama hipersônica (HVOF) através do método de difração de raios-X. Os revestimentos de Inconel 625 sobre substrato de aço ABNT 4140 foram produzidos por aspersão térmica utilizando-se dois equipamentos com os seguintes combustíveis para produção da chama: um combustível gasoso, o propano e um combustível líquido, o querosene. Realizou-se a análise de topo, em pontos aleatórios, das amostras para quantificar as tensões residuais e, após, esta medida inicial obteve-se a construção de um perfil de tensões residuais através do método de remoção de camada, em média de 10 - 20 μm do revestimento de Inconel 625. Este trabalho também tem interesse em avaliar além das tensões residuais, se as características dos revestimentos de Inconel 625 também variam em função do combustível utilizado na aspersão térmica. A morfologia dos revestimentos obtidos foi analisada por microscopia óptica. A rugosidade dos revestimentos foi avaliada por trilha medida no rugosímetro. Foi avaliada a dureza através do perfil longitudinal pelo ensaio de micro dureza Vickers. A tendência da superfície a apresentar hidrofilia ou hidrofobicidade foi avaliada pela molhabilidade através do método da gota séssil. A resistência a corrosão dos revestimentos foram avaliados pelos ensaios de névoa salina, monitoramento do potencial de circuito aberto e pelas curvas de polarização potenciodinâmica em água do mar sintética. Neste trabalho após os ensaios realizados para ambos os revestimentos obtidos por HVOF, utilizando-se duas fontes de combustível distintas, notam-se diferenças quanto ao perfil de tensões residuais, microestrutura, desempenho frente à corrosão, sendo que o processo com combustível líquido apresentou melhor desempenho. / The thermal spray flame hypersonic has been highlighted by the rapid and efficient method for applying coatings with big advantages: time, cost and quality. Inconel 625 coatings have a number of industrial applications especially in industries: chemical and petrochemical. In this context, the current study aims to evaluate the residual stresses in Inconel 625 coatings obtained by thermal spray hypersonic flame (HVOF) through the X – ray diffraction method. The Inconel 625 coating on SAE 4140 steel substrate was produced by thermal spraying using two equipments with the following fuel flame production: a gaseous fuel, propane or a liquid fuel, kerosene. Was performed top consideration in random points, the samples to quantify residual stresses, and after this initial measurement was obtained building a profile of residual stresses by layer removal method, on average 10 - 20 μm of Inconel 625 coating. This work also has an interest in evaluating besides the residual stresses, the characteristics of Inconel 625 coatings also vary depending on the fuel used in thermal spraying. The morphology of the coatings obtained was analyzed by optical microscopy. The roughness of the coatings was evaluated by measuring the track roughness. The hardness was evaluated by the longitudinal profile by micro Vickers hardness test. The tendency of the surface to provide hydrophilicity or hydrophobicity was evaluated by the wettability by sessile drop method. The corrosion resistance of the coatings was evaluated by salt spray tests, monitoring the open circuit potential and the potentiodynamic polarization curves in synthetic sea water. In this work after the tests carried out for both coatings obtained by HVOF, using two sources of different fuel, are noticeable differences in the profile of residual stresses, microstructure performance against corrosion, being the process liquid fuel showed better performance.