Αντικείμενο μελέτης της παρούσας διπλωματικής ερευνητικής εργασίας αποτελεί η ταυτοποίηση και η διερεύνηση της βιολογικής δράσης του πεπτιδίου που αποκόπτεται από τον υποδοχέα PAR1 μετά την ενεργοποίηση του από την θρομβίνη. Το υπεύθυνο γονίδιο για την έκφραση του υποδοχέα PAR1 κωδικοποιεί μια πολυπεπτιδική αλυσίδα μήκους 425 αμινοξέων. Έχει προταθεί ότι τα πρώτα 21-23 αμινοξέα του αμινοτελικού άκρου του μορίου αυτού πιθανόν να αποτελούν σηματοδοτική αλληλουχία υπεύθυνη για την μεταφορά και τοποθέτηση του υποδοχέα στην κυτταρική μεμβράνη. Η σηματοδοτική αυτή αλληλουχία είναι άγνωστο προς το παρόν αν παραμένει στον ώριμο PAR1 υποδοχέα ή απομακρύνεται με πρωτεόλυση πριν την εμφάνιση του PAR1 στην κυτταρική μεμβράνη. Ο υποδοχέας PAR1 ανήκει στην μεγάλη οικογένεια υποδοχέων των επτά διαμεμβρανικών τμημάτων (seven transmembrane domain receptor family) που διασυνδέονται με G πρωτεΐνες (G protein-coupled receptors, GPCRs). Επιπλέον, επειδή η ενεργοποίηση του υποδοχέα απαιτεί την ενζυμική δράση της θρομβίνης, ορίζεται με αυτόν τον τρόπο μία νέα οικογένεια διαμεμβρανικών υποδοχέων που ενεργοποιούνται από πρωτεάσες (Proteinase-Activated Receptors, PARs). Η θρομβίνη αναγνωρίζει για πέψη μια θέση στην αλληλουχία του εξωκυττατικού αμινοτελικού άκρου μεταξύ των αμινοξέων Arg41-Ser42 του υποδοχέα PAR1. Η πέψη αυτού του πεπτιδικού δεσμού οδηγεί στην απελευθέρωση ενός πεπτιδίου (Thrombin Receptor Peptide, TR) και στην δημιουργία ενός νέου αμινοτελικού άκρου για τον υποδοχέα, που λειτουργεί ως αγωνιστής και ενεργοποιεί τον PAR1. Έχει δειχθεί ότι η θρομβίνη και ο υποδοχέας PAR1 εμπλέκονται σε αρκετές παθοφυσιολογικές καταστάσεις. Ωστόσο δεν υπάρχουν επαρκείς πληροφορίες για την δράση του πεπτιδίου που αποκόπτεται. Χρησιμοποιώντας την τεχνολογία HPLC/MS έγινε προσπάθεια για την ταυτοποίηση του πραγματικού μεγέθους του πεπτιδίου που αποκόπτεται από τον PAR1 υποδοχέα. Τα πρώτα αποτελέσματα της εφαρμογής αυτής 55 οδήγησαν στο συμπέρασμα ότι κρίνεται απαραίτητη η περεταίρω βελτίωση των συνθηκών ανίχνευσης του πεπτιδίου, ώστε να επιτρέπεται η ανίχνευση του κατά την φόρτωση 1 ng στην στήλη της υγρής χρωματογραφίας. Πιο συγκεκριμένα η αντιμετώπιση της υψηλής πολικότητας του TR23-41 και η ενίσχυση ευαισθησίας του TR1-41 με την χρήση διαφορετικού διαλύτη ή με την χρήση διαφορετικής στήλης ή και ακόμα ο συνδυασμός διαφορετικού διαλύτη και στήλης, που αποτελεί και την μέχρι τώρα πιο πιθανή εκδοχή αντιμετώπισης των παραπάνω προβλημάτων, πιθανόν να δώσουν λύση στο πρόβλημα ανίχνευσης σε χαμηλές συγκεντρώσεις πεπτιδίου. Επιπλέον με την χρήση τεχνικής ελέγχου DNA σύνθεσης εξετάστηκε η επίδραση του TR1-41 πεπτιδίου σε HUVECs. Σκοπός αυτών των πειραμάτων δεν ήταν μόνο η εύρεση τυχόν βιολογικής δράσης του πεπτιδίου αλλά και η εύρεση ελάχιστης συγκέντρωσης του πεπτιδίου που προκαλεί αναστολή στην σύνθεση του DNA σε καλλιέργειες ενδοθηλιακών κυττάρων στις οποίες έχει προηγηθεί συνθήκες νηστείας. Τα αποτελέσματα αποκάλυψαν ότι το TR1-41 πεπτίδιο προκαλεί αναστολή στην σύνθεση του DNA και μάλιστα σε ελάχιστη συγκέντρωση 30nM, παρουσία ή μη του αυξητικού παράγοντα VEGF. Μελλοντικές έρευνες με βάση τα παραπάνω αποτελέσματα μπορούν να οδηγήσουν στην ταυτοποίηση του πραγματικού μεγέθους του πεπτιδίου που αποκόπτεται μετά την τοποθέτηση και ενεργοποίηση του PAR1 στην κυτταρική μεμβράνη και κατ’ επέκταση στην λεπτομερή διερεύνηση της βιολογικής δράσης του πεπτιδίου αυτού. Γνωρίζοντας την ανάμιξη της θρομβίνης και του υποδοχέα της σε παθοφυσιολογικές καταστάσεις η ταυτοποίηση του πεπτιδίου και η γνώση της βιολογικής του δράσης μελλοντικά θα αποτελέσει ένα χρήσιμο προγνωστικό και διαγνωστικό δείκτη. / In the context of the MSc dissertation described herein, the objective of the research work constitutes in the identification of the real number of amino acids of the peptide that is being released after the activation of PAR1 by thrombin and the examination of its biological action. The responsible gene for the PAR1 expression codifies a polypeptide chain of 425 amino acids. It is under consideration that the first 21-23 amino acids of the exodomain N-terminal sequence of the receptor may be a signaling sequence, responsible for the transfer and placement of the receptor to the cell membrane. It is not known so far if the signaling sequence remains on the receptor after its placement on the cell membrane. PAR1 belongs to the family of the seven transmembrane domain receptor, the G protein-coupled receptors (GPCRs). PAR1 requires the enzymic activity of thrombin for its activation, and so a new family of transmembrane receptors is being defined, the Proteinase-Activated Receptors (PARs). Thrombin recognizes and cleaves the N-terminal exodomain of PAR1 between Arg41-Ser42 amino acids. This cleavage event releases a peptide (Thrombin Receptor Peptide, TR) and so unmasks a new N-terminus of the receptor, which acts as PAR1 agonist and activates the receptor. It has been proved that thrombin and PAR1 are being involved in many pathophysiological situations. So far there isn’t enough information of the biological action of the peptide that is being realized from PAR1. The use of HPLC/MS technology wasn’t able to reveal the real number of this peptide because of the intensity of TR1-41 in 1ng on column and the extreme polarity of TR24-41. instead of these results we strongly believe that the use of different solvents will increase the intensity of TR1-41 in 1ng on column. Also the use of C8 column instead of C4 probably will contribute in the traceability of TR24-41. The biological action of TR1-41 was examined with the use of DNA synthesis control technique in HUVECs cultivation after starvation. These experiments showed that the use of TR1-41 caused reduction of the DNA synthesis in HUVECs. We also examined the lower concentration of TR1-41 57 that was able to reduce the DNA synthesis in HUVECs. TR1-41 was able to reduce DNA synthesis in minimum concentration of 30 nM even in the presence of VEGF. The above results in association with future research can constitute in the identification of the real size of the peptide that is being released after the activation of PAR1, as in the biological action of this peptide. Knowing so far that thrombin and PAR1 are being involved in pathophysiological situations this peptide will constitute in the future as a useful prognostic and diagnostic marker.

Objectifs : Les lymphocytes T régulateurs de par leur rôle primordial dans l'homéostasie de la réponse immune sont des cellules idéales pour une immunothérapie antigène-spécifique dans les maladies auto-immunes. Les lymphocytes T régulateurs de type 1 ou Tr1 sont caractérisées par une forte sécrétion d'IL-10, cytokine qui joue un rôle déterminant dans leur capacité à supprimer des réponses immunes pathologiques dans différents contextes. L'objectif de ma thèse est d'évaluer le potentiel thérapeutique de cellules Tr1 spécifiques du collagène de type II (col-Treg) dans deux modèles de polyarthrite rhumatoïde (PR) chez la souris. Méthode : Les clones Col-Treg ne possèdent pas de marqueurs membranaires spécifiques mais sont caractérisés par un profil cytokinique particulier (IL10highIL4negIFN-γint) et par leur capacité de suppression in vitro. Tout comme les Tregs naturels, ils expriment une quantité importante de GITR, de CD39 et de Granzyme B. Une simple injection de cellules Col-Treg réduit l'incidence et les symptômes cliniques de l'arthrite à la fois de manière préventive et curative, avec un impact significatif sur les anticorps anti-collagène de type II. En outre, l'injection de Tr1 antigène spécifique in vivo diminue de manière significative la prolifération des cellules T antigène spécifique. Conclusion : Nos résultats démontrent le potentiel thérapeutique des cellules Col-Treg dans deux modèles d'arthrite expérimentale prouvant que les cellules Col-Treg représente une nouvelle approche thérapeutique de choix pour le traitement des patients atteint de polyarthrite et réfractaires aux traitements actuels. / Objectives : Regulatory T (Treg) cells play a crucial role in preventing autoimmune diseases and are an ideal target for therapies to suppress inflammation in an antigen-specific manner. Type 1 Treg cells (Tr1) are defined by their capacity to produce high levels of IL10, which contributes to their ability to suppress pathological immune responses in several settings. The aim of my PhD was to evaluate the therapeutic potential of collagen type II-specific Tr1 (Col-Treg) cells in two models of rheumatoid arthritis (RA) in mice. Methods : Col-Treg clones were isolated and expanded from Collagen-specific TCR transgenic mice. Their cytokine secretion profile and phenotype characterization were studied. The therapeutic potential of Col-Treg cells was evaluated after adoptive transfer in collagen-antibodies- and collagen-induced arthritis models. The in vivo suppressive mechanism on effector T cell proliferation was also investigated. Results : Col-Treg clones are characterized by a cytokine profile (IL10highIL4negIFN-γint) and mediate contact-independent immune suppression. They also share with natural Tregs high expression of GITR, CD39 and Granzyme B. Single infusion of Col-Treg cells reduced incidence and clinical symptoms of arthritis both in preventive and curative settings, with a significant impact on collagen type II antibodies. Importantly, injection of antigen-specific type 1 Treg cells decreases significantly the proliferation of antigen-specific effector T cells in vivo. Conclusion : Our results demonstrate the therapeutic potential of Col-Treg cells in two models of RA, providing evidence that Col-Treg could be an efficient cell-based therapy for RA patients refractory to current treatments.

Produzida por macrófagos e células dendríticas, a IL-27 é uma citocina heterodimérica capaz de induzir células Tr1 produtoras de IL-10 e consequentemente regular linfócitos Th1, Th2 e Th17, dependendo da doença envolvida. Partindo-se do pressuposto de que a infecção causada por Trypanosoma cruzi normalmente induz miocardite refletida pela migração intensa de linfócitos Th1 para o tecido cardíaco, nós analisamos o papel regulador da IL-27 nesta condição inflamatória. Nós inicialmente verificamos que a IL-27 foi prontamente induzida in vitro em células infectadas com T. cruzi. Para gerar miocardite intensa coordenada por linfócitos Th1, nós polarizamos linfócitos T naïves para o padrão Th1 na ausência de moléculas relacionadas ao perfil Th17 (camundongos IL-17R-/-, IL-23-/- e IL-6-/-). Como esperado, a inflamação cardíaca intensa e o dano tecidual foram observados na ausência das moléculas do padrão Th17, o que contribuiu para a morte prematura dos animais IL-17R-/-, IL-23-/- e IL-6-/-, precisa e notoriamente pela indução da migração excessiva de linfócitos Th1 para o tecido cardíaco via CXCL-9 e CXCL-10. Para explorar os mecanismos pelos quais a IL-27 controla a miocardite induzida pelo T. cruzi, nós encontramos um recrutamento substancial de macrófagos produtores de IL-27 para o tecido cardíaco, o qual foi mediado pelas quimiocinas CCL3 e CCL4 na ausência de moléculas do padrão Th17. Para determinar quais os receptores necessários para a produção de IL-27, nós observamos que macrófagos derivados da medula óssea de camundongos deficientes de TLR4-/-, TLR9-/- e NLRP3-/- aboliram completamente a produção desta citocina após a infecção in vitro com T. cruzi, enquanto o receptor TLR2 foi dispensável. Nós também verificamos que macrófagos produtores de IL-27 suprimiram linfócitos Th1 através da indução de células Tr1 produtoras de IL-10 após a infecção com T. cruzi. Em seguida, nós avaliamos se a IL-27 foi correlacionada com a proteção cardíaca durante a doença de Chagas. Nós observamos níveis séricos elevados de IL-27 tanto em pacientes com a forma clínica indeterminada ou cardíaca leve, enquanto pacientes com cardiomiopatia moderada ou grave produziram níveis reduzidos de IL-27. Neste estudo, nós descrevemos um novo mecanismo regulador desempenhado por macrófagos produtores de IL-27 no controle da miocardite induzida por T. cruzi. Macrófagos produtores de IL-27 podem suprimir processos inflamatórios desencadeados por linfócitos Th1, os principais vilões na doença de Chagas. / IL-27 is a heterodimeric cytokine produced by macrophages and dendritic cells known to induce IL-10-producing Tr1 cells and to regulate Th1, Th2, and Th17 lymphocytes, depending on the underlying disease. Because the infection caused by Trypanosoma cruzi normally induces myocarditis mirrored by an outstanding migration of Th1 cells to the heart tissue, we analyzed the regulatory role of IL-27 in this inflammatory condition. We firstly verified that IL-27 was promptly induced by in vitro T. cruzi-infected spleen cells. To generate a robust myocarditis coordinated by Th1 lymphocytes, we polarized lymphocytes to a Th1 pattern by infecting mice in the absence of Th17-related molecules (IL-17R-/-, IL-23-/-, and IL-6-/- mice). As expected, an impressive cardiac inflammation and damage was observed in the absence of Th17-related molecules, leading IL-17R-/-, IL-23-/-, and IL-6-/- mice to the premature death, precisely and notably by inducing an exuberant Th1 migration to the heart tissue via CXCL9 and CXCL10 chemokines. To explore the mechanisms by which IL-27 controls T. cruzi-induced myocarditis, we found a striking recruitment of IL-27-producing macrophages to the heart tissue mediated by increased levels of CCL3 and CCL4 chemokines in the absence of Th17-associated molecules. To gain further insights into the receptors required to IL-27 production, we observed that bone marrow-derived macrophages from TLR4-/-, TLR9-/-, and NLRP3-/- mice completely abolished IL-27 production after in vitro T. cruzi infection, while TLR2 was dispensable. We also verified that IL-27-producing macrophages supressed Th1 lymphocytes by inducing IL-10-producing Tr1 cells after T. cruzi infection. We next assessed whether IL-27 was correlated to cardiac protection during Chagas Disease. We observed augmented serum levels of IL-27 in either patients with indeterminate (asymptomatic) form or mild cardiac form, whereas patients with moderate or severe cardiomyopathy were poor producers of IL-27. Here, we described a novel regulatory mechanism developed by IL-27-producing macrophages in the control of T. cruzi-induced myocarditis. IL-27-producing macrophages can suppress inflammatory processes caused by Th1 lymphocytes, the bona fide culprits of Chagas Disease.

Produzida por macrófagos e células dendríticas, a IL-27 é uma citocina heterodimérica capaz de induzir células Tr1 produtoras de IL-10 e consequentemente regular linfócitos Th1, Th2 e Th17, dependendo da doença envolvida. Partindo-se do pressuposto de que a infecção causada por Trypanosoma cruzi normalmente induz miocardite refletida pela migração intensa de linfócitos Th1 para o tecido cardíaco, nós analisamos o papel regulador da IL-27 nesta condição inflamatória. Nós inicialmente verificamos que a IL-27 foi prontamente induzida in vitro em células infectadas com T. cruzi. Para gerar miocardite intensa coordenada por linfócitos Th1, nós polarizamos linfócitos T naïves para o padrão Th1 na ausência de moléculas relacionadas ao perfil Th17 (camundongos IL-17R-/-, IL-23-/- e IL-6-/-). Como esperado, a inflamação cardíaca intensa e o dano tecidual foram observados na ausência das moléculas do padrão Th17, o que contribuiu para a morte prematura dos animais IL-17R-/-, IL-23-/- e IL-6-/-, precisa e notoriamente pela indução da migração excessiva de linfócitos Th1 para o tecido cardíaco via CXCL-9 e CXCL-10. Para explorar os mecanismos pelos quais a IL-27 controla a miocardite induzida pelo T. cruzi, nós encontramos um recrutamento substancial de macrófagos produtores de IL-27 para o tecido cardíaco, o qual foi mediado pelas quimiocinas CCL3 e CCL4 na ausência de moléculas do padrão Th17. Para determinar quais os receptores necessários para a produção de IL-27, nós observamos que macrófagos derivados da medula óssea de camundongos deficientes de TLR4-/-, TLR9-/- e NLRP3-/- aboliram completamente a produção desta citocina após a infecção in vitro com T. cruzi, enquanto o receptor TLR2 foi dispensável. Nós também verificamos que macrófagos produtores de IL-27 suprimiram linfócitos Th1 através da indução de células Tr1 produtoras de IL-10 após a infecção com T. cruzi. Em seguida, nós avaliamos se a IL-27 foi correlacionada com a proteção cardíaca durante a doença de Chagas. Nós observamos níveis séricos elevados de IL-27 tanto em pacientes com a forma clínica indeterminada ou cardíaca leve, enquanto pacientes com cardiomiopatia moderada ou grave produziram níveis reduzidos de IL-27. Neste estudo, nós descrevemos um novo mecanismo regulador desempenhado por macrófagos produtores de IL-27 no controle da miocardite induzida por T. cruzi. Macrófagos produtores de IL-27 podem suprimir processos inflamatórios desencadeados por linfócitos Th1, os principais vilões na doença de Chagas. / IL-27 is a heterodimeric cytokine produced by macrophages and dendritic cells known to induce IL-10-producing Tr1 cells and to regulate Th1, Th2, and Th17 lymphocytes, depending on the underlying disease. Because the infection caused by Trypanosoma cruzi normally induces myocarditis mirrored by an outstanding migration of Th1 cells to the heart tissue, we analyzed the regulatory role of IL-27 in this inflammatory condition. We firstly verified that IL-27 was promptly induced by in vitro T. cruzi-infected spleen cells. To generate a robust myocarditis coordinated by Th1 lymphocytes, we polarized lymphocytes to a Th1 pattern by infecting mice in the absence of Th17-related molecules (IL-17R-/-, IL-23-/-, and IL-6-/- mice). As expected, an impressive cardiac inflammation and damage was observed in the absence of Th17-related molecules, leading IL-17R-/-, IL-23-/-, and IL-6-/- mice to the premature death, precisely and notably by inducing an exuberant Th1 migration to the heart tissue via CXCL9 and CXCL10 chemokines. To explore the mechanisms by which IL-27 controls T. cruzi-induced myocarditis, we found a striking recruitment of IL-27-producing macrophages to the heart tissue mediated by increased levels of CCL3 and CCL4 chemokines in the absence of Th17-associated molecules. To gain further insights into the receptors required to IL-27 production, we observed that bone marrow-derived macrophages from TLR4-/-, TLR9-/-, and NLRP3-/- mice completely abolished IL-27 production after in vitro T. cruzi infection, while TLR2 was dispensable. We also verified that IL-27-producing macrophages supressed Th1 lymphocytes by inducing IL-10-producing Tr1 cells after T. cruzi infection. We next assessed whether IL-27 was correlated to cardiac protection during Chagas Disease. We observed augmented serum levels of IL-27 in either patients with indeterminate (asymptomatic) form or mild cardiac form, whereas patients with moderate or severe cardiomyopathy were poor producers of IL-27. Here, we described a novel regulatory mechanism developed by IL-27-producing macrophages in the control of T. cruzi-induced myocarditis. IL-27-producing macrophages can suppress inflammatory processes caused by Th1 lymphocytes, the bona fide culprits of Chagas Disease.

Les résultats de la transplantation hépatique (TH) se sont considérablement améliorés mais la survie à long terme est une préoccupation des transplanteurs. Elle dépend de la survenue d’un rejet, de la récidive de l’hépatite C, du traitement immunosuppresseur et de ses complications. Après une TH suite à une complication de l’hépatite C, l'infection du greffon par le virus de l’hépatite C (VHC) est constante, et l'évolution de l'hépatite chronique est plus rapide et agressive que chez les non transplantés. L’implication des cellules T régulatrices (Treg) a été suggérée dans l’induction de tolérance après transplantation et dans la persistance de l’infection par le VHC. Le nombre et la fonction des Treg seraient influencés par le traitement immunosuppresseur (IS). Dans ce contexte, je me suis intéressé au rôle des Treg dans l’évolution de la TH, et les effets des différents traitements utilisés (IS et anti-VHC) sur ces cellules. Les résultats montrent que les Treg, en particulier les cellules régulatrices de type 1 (Tr1), seraient prédictifs de la réponse au traitement antiviral C, et aussi que les Treg pourraient être impliquées dans l’évolution de la récidive virale C après TH. JE montre aussi que les inhibiteurs de mTor induisent une augmentation de taux des Treg chez les patients transplantés hépatiques après changement du traitement d’un anticalcineurine, et que les anticalcinurines réagissent différemment sur l’activité suppressive des Treg in vitro. En conclusion, je précise le rôle majeur des Treg à la fois dans l’évolution de la récidive virale C sur le greffon hépatique, mais également quels sont les IS qui auraient un effet favorable sur le développement des Treg. / The results of liver transplantation (LT) have improved significantly, but long-term graft survival is still a major concern for doctors. It depends on the rejection rates, the recurrence of hepatitis C, and the immunosuppressive treatment and its complications. After LT, the graft reinfection with HCV is constant, and the evolution of chronic hepatitis is faster and more aggressive when compared to the time course before transplantation. It has been suggested the regulatory T cells (Treg) are involved in the induction of tolerance after organ transplantation, and in the persistence of HCV infection by suppressing the HCV-specific T responses. Furthermore, the number and function of Treg are very likely influenced by the immunosuppressive therapy used after transplantation. In this context, my work focuses on the role of Treg cells in the evolution of liver transplantation, and the effects of different treatments used after LT (immunosuppressive and anti-HCV) on this population. The results of my thesis show that the Treg cells (Type-1 regulatory cells, Tr1, in particular) are predictive of the response to the anti-HCV treatment after LT, and that Treg cells are associated with severe evolution of recurrent hepatitis C. I show that mTOR inhibitors have a positive impact on the number of circulating Treg cells in patients who underwent a conversion of therapy from Tacrolimus to a mTOR inhibitor, and that calcinurine inhibitors have different effects on Treg suppressive activity in vitro. In conclusion, we bring evidences on the involvement of Treg cells in HCV recurrence and treatment failure after liver transplantation and in their interaction with immunosuppressive drugs.

Η αγγειογένεση ρυθμίζει πολλές φυσιολογικές και παθολογικές διαδικασίες. Έτσι είναι μεγάλου ενδιαφέροντος να ανακαλυφθούν μηχανισμοί που συμμετέχουν. Στο πρώτο μέρος της μεταπτυχιακής εργασίας πραγματοποιήθηκε η σύνθεση των τριών πεπτιδίων, ανάλογα ΤR1-41). Στην συνέχεια μελετήθηκε ο βιολογικός ρόλος του ΤR1-41. Είναι γνωστό ότι η θρομβίνη, η πρωτεάση σερίνης, έχει κεντρικό ρόλο στην αιμόσταση, και έχει προταθεί για να διαδραματίσει έναν σημαντικό ρόλο στην έναρξη της αγγειογέννεσης μέσω της μεταγωγής σήματος από τους PARs υποδοχέων. Οι PARs αποτελούνται μια νέα οικογένεια πρωτεϊνικών υποδοχέων των επτά διαμεμβρανικών τμημάτων (seven transmembrane domain receptor family) που διασυνδέονται με G πρωτεΐνες. Mοριακές και δομικές μελέτες του υποδοχέα της θρομβίνης, PAR-1, έδειξαν ότι το εξωκυτταρικό αμινοτελικό άκρο του είναι μακρύ και αποτελείται από 75 αμινοξέα. Επιπλέον, στην αλληλουχία του αμινοτελικού άκρου εντοπίστηκε μία θέση θετική για πέψη από τη θρομβίνη στη θέση μεταξύ της Arg41 και Ser42. Πράγματι η σύνδεση της θρομβίνης με τον PAR-1 έχει ως συνέπεια την εκλεκτική υδρόλυση του πεπτιδικού δεσμού LDPR41- S42FLLRN. Το αποτέλεσμα από την υδρόλυση αυτή, είναι η δημιουργία ενός ελεύθερου πεπτιδίου 41 αμινοξέων( Thrombin Receptor Peptide 1-41, TR1-41), και ενός νέου αμινοτελικού άκρου για τον υποδοχέα. Σε αντίθεση με το νέο αμινοτελικό άκρο του υποδοχέα της θρομβίνης (PAR-1), ο ρόλος του πεπτιδίου των 41 αμινοξέων (TR1-41) που αποκόπτεται με τη πρωτεολυτική δράση της θρομβίνης μεταξύ των αμινοξέων Arg41-Ser42 είναι σχεδόν άγνωστος. Στην παρούσα μελέτη, αξιολογήσαμε την επίδραση αυτού του πεπτιδίου (MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR) στα καλλιεργημένα ανθρώπινα ενδοθηλιακά κύτταρα. Η έκθεση των ενδοθηλιακών κυττάρων στο πεπτίδιο οδήγησε σε μια δοσοεξαρτώμενη αναστολή του πολλαπλασιασμού των κυττάρων, καθώς επίσης και της δράσης των bFGF και VEGF. Επίσης υπήρχε η ένδειξη ότι το πεπτίδιο TR1-41 αναστέλλει σε συνθήκες ορού 5% FBS, τη δράση bFGF μέσω του μονοπατιού της MAP-κινάσης και μέσω του Erk1/2. Αντίθετα, καμία επίδραση δεν παρατηρήθηκε στα κύτταρα στα οποία χορηγήθηκε το scrambled peptide (πεπτίδιο 41 αμινοξέων με αναγραμματισμένη σειρά αμινοξέων) ή και μικρότερα πεπτίδια αυτού (TRARRPESKATNATLDPR). Επίσης το πεπτίδιο TR1-41 παρουσιάζει ανασταλτική δράση στον πολλαπλασιασμό των HUVECs και άλλων κυτταρικών σειρών. Τέλος, το πεπτίδιο TR1-41 εμπόδισε τον σχηματισμό αγγείων στο in vitro σύστημα της αγγειογέννεσης με υπόστρωμα Matrigel. Tο δεύτερο μέρος του μεταπτυχιακού μελετήθηκε ο βιολογικός ρόλος της ορμόνης μελατονίνης. Η μελατονίνη είναι το σημαντικότερο εκκριτικό προϊόν του κωνοειδούς αδένα και σε γενικές γραμμές εμφανίζει ογκοστατικές, αντιγηραντικές, αντιοξειδωτικές, νευροπροστατευτικές, υπνωτικές, ορεξιογόνες, αναλγητικές, θερμορυθμιστικές,και καρδιαγγειακές ιδιότητες, ενώ παρουσιάζει ανασταλτική δράση στη διαδικασία της αναπαραγωγής και μετατοπίζει τις φάσεις του «βιολογικού ρολογιού». Από τα πειράματά μας στα πρωτογενή ανθρώπινα ενδοθηλιακά κύτταρα (HUVECs) η επίδραση της μελατονίνης φαίνεται διφασική. Στις χαμηλές συγκεντρώσεις μελατονίνης αυξάνεται ο πολλαπλασιασμός των HUVECς. Στις υψηλές συγκεντρώσεις αναστέλλει τον πολλαπλασιασμό των HUVECς. / Angiogenesis regulates many physiological and pathological processes, so it is of great interest to find out which mechanisms that are involved. In the first part of the project we synthesised three peptides, analogs of ΤR1-41 and we studied the biological role of the ΤR1-41. It is known that thrombin, the serine proteinase, best known for its pivotal role in haemostasis, has been proposed to play an important role in the initiation of angiogenesis by a mechanism most likely independent of its coagulant activity and more dependent on signaling via the protease-activated receptors (PARs). PARs consists a novel family of G protein-coupled receptors, which can be activated by proteolytic cleavage of their N-terminal extracellular domain. PAR-1 is the first member of this family to be cloned in which proteolytic cleavage at the R41/S42 bond by thrombin releases a 41 aminoacid peptide and unveils a tethered peptide ligand with the recognition sequence SFLLRN. Despite the wealth of information relating to the role of thrombin and PAR-1 innormal and disease states, a potential biological role of cleaved peptide remains unknown. In the present study, we evaluated the effect of the 41-amino-acid cleaved peptide, (MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR) in cultured human endothelial cells. Exposure of endothelial cells to this peptide resulted in a concentration-dependent inhibition of serum-mediated proliferation, as well as of bFGF- and VEGF-induced cell growth. There was the suspicion that the peptide blocked the serum, bFGF-triggered Erk1/2 activation. In contrast, no effect was observed in cells treated with a scramble peptide or with a shorter derivative of parstatin (TRARRPESKATNATLDPR). Finally, ΤR1-41 peptide abrogated tube formation in vitro Matrigel angiogenesis model. These results provide a plausible evidence for a negative role of PAR-1 cleaved peptide in angiogenic cascade and suggest parstatin as target for developing anti-angiogenic agents with potential therapeutic application in cancer and other angiogenesis-related diseases. The second part of the project was the biological role of melatonin. Melatonin is the major secretory product of the pineal gland and is considered an important natural oncostatic agent. From our experiments in human umbilical vein endothelial cells (HUVECs) the effect of melatonin seems to be biphasic. In low concentrations melatonin increased HUVEC proliferation, but in higher concentrations significantly decreased cell proliferation.

La plupart des infections par le VIH-1 sont acquises lors de rapports hétérosexuels. En Afrique subsaharienne on observe 71 % des infections mondiales et 60 % des nouvelles infections par le VIH-1 touchent les femmes. Le tractus génital féminin (TGF) constitue la principale porte d’entrée pour le VIH-1 et joue un rôle important dans la défense de l’organisme contre les microorganismes pathogènes tout en maintenant une tolérance de la flore commensale. On y trouve les cellules épithéliales qui participent à l’élaboration des réponses immunes en collaboration avec les cellules dendritiques (DCs), mais également d’autres types de cellules immunitaires qui confèrent une protection à la muqueuse vaginale, notamment à travers la production de cytokines et de chimiokines. Nous avons établi une cohorte de travailleuses du sexe (CSWs) au Bénin et nous avons identifié des femmes hautement exposées et séronégatives au VIH-1 (HESN), qui demeurent séronégatives après plus de sept années actives dans le travail du sexe. Les personnes HESN étant un excellent modèle d’immunité naturelle contre le VIH-1, le but de notre projet consiste donc à étudier les cellules immunitaires impliquées dans la protection de l’hôte face au VIH-1, au niveau du tractus génital féminin. Nous émettons l’hypothèse que le maintien de faibles conditions inflammatoires dans le TGF des femmes HESN préviendrait une activation immunitaire excessive en préservant l’intégrité de la barrière de la muqueuse vaginale et contribuerait ainsi à maintenir une protection contre l’infection par le VIH-1. Des études antérieures sur les HESN béninoises et kenyanes ont démontré que ces femmes présentent de faibles niveaux d’inflammation dans leur TGF inférieur. En accord avec cela, nous avons observé de faibles niveaux de BLyS/BAFF dans la muqueuse vaginale des HESN comparativement aux travailleuses du sexe séropositives (CSWs+ HIV+). BLyS/BAFF est une molécule importante pour la différenciation des cellules B et pour la sélection de cellules B de première ligne de la zone marginale (MZ). De ce fait, nous rapportons pour la première fois la présence de cellules B CD1c+ de type MZ qui sont capables de se lier naturellement à la gp120 glycosylée, au niveau de la muqueuse vaginale. Or, des cellules B CD1c+ exprimant IgG sont augmentées chez les CSWs+ HIV+ comparativement aux HESN, ce qui pourrait contribuer à l’hyperglobulinémie observée dans le TGF inférieur des CSWs+ HIV+. Les faibles niveaux de BLyS/BAFF retrouvés dans la muqueuse vaginale des HESN semblent donc préserver une homéostasie au sein du compartiment B et des cellules B CD1c+ du TGF. De plus, nous y détectons une réactivité des IgG1 avec la gp-41 de l’enveloppe virale, qui pourrait contribuer à leur immunité naturelle. Avec les cellules épithéliales, les DCs sont l’une des premières à être en contact avec le virus dans le TGF. Elles jouent un rôle essentiel dans l’orchestration des réponses immunitaires. Nous pensons que les DCs contribuent au maintien de faibles conditions inflammatoires dans le TGF des HESN, prévenant ainsi l’activation immunitaire excessive et préservant l’intégrité de la barrière muqueuse de façon à maintenir une protection/contrôle contre le virus. Nous avons caractérisé une population myéloïde endocervicale « tolérogénique » HLA-DR+CD14+CD11c+ exprimant HLA-G, ILT4, CD103 et de forts taux d’IFN-α et d’IL-10 dont la fréquence relative était augmentée au niveau du col de l’utérus des HESN comparativement aux CSWs+ HIV+. De plus, des populations Tregs/Tr1 étaient aussi augmentées chez les HESN. Ces données reflètent à la fois une réponse antivirale et une contribution au contrôle des conditions inflammatoires dans le TGF des HESN. Afin de mieux comprendre la nature des cellules myéloïdes tolérogéniques, nous avons voulu dériver des monocytes en cellules dendritiques (MoDCs). Toutefois, nous avons remarqué que la différenciation des MoDCs des HESN était altérée. Suite à cela, nous avons caractérisé le profil transcriptomique des monocytes. Les résultats préliminaires mettent en lumière l’éventuel rôle des récepteurs nucléaires NR4A dans la modulation des MoDCs et, possiblement, sur le plan des cellules myéloïdes tolérogéniques chez les HESN. Dans l’ensemble, ces résultats nous ont permis d’acquérir de nouvelles connaissances sur les mécanismes mis en place chez les HESN dans l’immunité naturelle contre le VIH-1. / Most HIV-1 infections are acquired through heterosexual intercourse. In sub-Saharan Africa, 71% of global infections are observed and 60% of new HIV-1 infections affect women. The female genital tract (FGT) constitutes a main portal of entry for HIV-1 and plays an important role in protecting the host against pathogens while maintaining a tolerance to a commensal flora. FGT immunity involves genital epithelial cells as well as dendritic cells (DCs) and many other types of immune cells which confer protection, through the production of chemokines and cytokines. We established a cohort of commercial sex workers (CSWs) in Benin and identified HIV-1 highly exposed seronegative (HESN) individuals, who remain uninfected after more than seven years of active prostitution. These HESN individuals being an exceptional model of natural immunity against HIV-1, the aim of our project is to characterize immune cells involved in protection from HIV-1 infection, in the female genital tract. We hypothesize that maintenance of low inflammatory conditions in the FGT of HESN women helps to prevent excessive immune activation likely preserving the mucosal barrier integrity and would help to maintain a protection against HIV infection. Previous studies of Beninese and Kenyan HESN have shown that these women have a low inflammatory profile in their lower FGT. Accordingly, we found that vaginal mucosa of HESN had lower soluble BLyS/BAFF levels when compared to HIV-infected CSWs (CSWs+ HIV+). BLyS/BAFF is highly recognized for its role in B-cell ontogenesis, as well as cell fate decision towards the innate marginal zone (MZ) B-cell pool. For the first time, we report the presence of genital MZ-like CD1c+ B-cells that naturally bind to fully glycosylated gp120 in the vaginal mucosa. However, CD1c+ B-cells expressing IgG are increased in the lower FGT of CSWs+ HIV+ when compared to HESN, suggesting that these cells could contribute to the hyperglobulinemia observed in the lower FGT of CSWs+ HIV+. The low levels of BLyS/BAFF found in the vaginal mucosa of HESN thus appear to preserve homeostasis of the FGT B cell compartment and CD1c+ B-cells. In addition, we detect a reactivity of IgG1 to HIV-gp41 in cervico-vaginal lavages (CVL) supernatants of HESN, which could contribute to their natural immunity. Epithelial cells and DCs are one of the earliest cell types to sense the virus in the FGT. They play a key role in the orchestration of immune responses. We characterized a "tolerogenic" endocervical myeloid HLA-DR+CD14+CD11c+ population expressing HLA-G, ILT4, CD103 and high levels of IFN-α and IL-10, that was increased in the cervix of HESN when compared to CSWs+ HIV+. In addition, frequencies of Tregs/Tr1 cells were also increased in HESN. We believe that DCs contribute to maintaining low inflammatory conditions in the FGT of HESN, preventing excessive immune activation and preserving the integrity of the mucosal barrier to maintain a protection/control against the virus. These data reflect both an antiviral response and a contribution to the control of inflammatory conditions in the FGT of HESN. To better understand the nature of tolerogenic myeloid cells, we wanted to derive monocyte-derived dendritic cells (MoDCs). However, derivation of blood MoDCs was impaired in HESN. As a result, we decided to characterize the transcriptomic profile of total blood monocytes. Preliminary results appear to demonstrate the possible role of NR4A nuclear receptors in MoDCs modulation, and possibly in tolerogenic myeloid cells in HESN. Overall, our results contribute to a better understanding of the mechanisms established by HESN in natural immunity to HIV-1.