Orientador: Jaime Amaya-Farfán / Tese (doutorado) - Universidade Estadual de Campinas, Faculdade de Engenharia de Alimentos / Made available in DSpace on 2018-08-21T17:15:26Z (GMT). No. of bitstreams: 1 Morato_PriscilaNeder_D.pdf: 813172 bytes, checksum: 96f9ce7da352faefcc39166ef5fe4fa9 (MD5) Previous issue date: 2012 / Resumo: As proteínas do soro do leite apresentam propriedades nutricionais e funcionais que influenciam a modulação de funções bioquímicas e fisiológicas.Estudos têm demonstrado que as proteínas do soro do leite (PSL), principalmente na forma hidrolisada (PSLH) possuem a capacidade de aumentar os níveis de glicogênio muscular. Considerando que a captação de glicose pela célula do músculo esquelético relaciona-se diretamente à atividade de proteínas transportadoras de glicose, este estudo se propôs realizar dois experimentos para conhecer os efeitos da PSL e da PSLH e de alguns dos seus produtos de hidrólise nos transportadores de glicose em músculos de ratos. No experimento 1, o objetivo foi verificar se o consumo de PSL e PSLH modulam a concentração de transportadores de glicose GLUT-1 e GLUT-4 na membrana plasmática (MP) de células musculares de animais sedentários e exercitados. Foram utilizados 48 ratos Wistar machos divididos em dois grupos: sedentários e exercitados, e cada um desses subdivididos em outros três, de acordo com a dieta, totalizando 6 grupos (n=8 por grupo). Os animais foram mantidos por 9 dias recebendo as dietas experimentais baseadas na AIN-93G, com as seguintes fontes protéicas: caseína (CAS), utilizada como controle, proteína do soro do leite (PSL), proteína do soro do leite hidrolisada (PSLH), e o animais exercitados foram submetidos a uma única sessão de exercício a 15m/min durante 60min um dia anterior ao sacrifício. Após o período experimental os animais foram sacrificados, os transportadores de glicose no músculo, GLUT-1 e GLUT-4, foram analisados por western blot. Adicionalmente, glicogênio, aminoácidos livres plasmáticos, insulina e indicadores bioquímicos de saúde foram determinados por métodos padrões. O consumo de PSLH elevou significativamente as concentrações de GLUT-4 na MP e de glicogênio, enquanto GLUT-1, insulina e os indicadores de saúde não apresentaram alterações. Baseado nas evidências do experimento 1, de que o consumo de PSLH eleva os estoques de glicogênio muscular e que também aumenta a concentração do transportador de glicose GLUT-4 na membrana plasmática, o experimento 2 teve como objetivo identificar quais componentes da PSLH poderiam modular a translocação do transportador de glicose GLUT-4 para a MP em músculo esquelético. Foram utilizados 49 ratos Wistar machos divididos em 7 grupos (n=7), que receberam soluções orais de glicose 30% mais 0,55 g/kg de peso corpóreo os seguintes componentes da PSLH: a) glicose (controle); b) PSLH; c) L-isoleucina; d) L-leucina; e) L-leucina mais L-isoleucina; f) peptídeo Lisoleucil- L-leucina; g) peptídeo L-leucil-L-isoleucina. Após receberem as soluções, os animais foram sacrificados, o transportador de glicose GLUT-4 no músculo foi analisado por western blot. Também foram analisados glicogênio, glicemia, insulina, aminoácidos livres plasmáticos e musculares, e indicadores bioquímicos de saúde por métodos clássicos. Entre os componentes testados da PSLH, o peptídeo leucil-isoleucina e o aminoácido isoleucina se mostraram mais eficientes em translocar GLUT-4 para a MP, favorecendo a captação de glicose pelo músculo esquelético. Os resultados obtidos nos experimentos indicam que o consumo da PSLH e de seus componentes ao aumentarem a translocação de GLUT-4 para a membrana plasmática, poderiam auxiliar no tratamento ou prevenção do diabetes do tipo II / Abstract: The milk whey proteins (WP) exhibit nutritional and functional properties which result in the modulation of the biochemical and physiological functions. Studies have shown that the WP, especially those in the hydrolyzed form (WPH),has the capacity to increase muscle glycogen levels. Considering that glucose uptake by the skeletal muscle cell is directly related to the activity of the glucose transporter proteins, the present study proposed to carry out two experiments to determine the effects of WP and WPH and of some of their hydrolysis products on the glucose transporters in rat muscles. The objective of experiment 1 was to verify if the consumption of WP and WPH are able to modulate the concentration of the glucose transporters GLUT-1 and GLUT-4 in the plasma membrane (PM) of muscle cells in sedentary and exercised animals. Forty-eight male Wistar rats were used, divided into sedentary and exercised groups, each of which was sub-divided into three sub-groups according to the diet, giving a total of 6 groups (n=8 per group). The animals were maintained for 9 days on experimental diets based on AIN-93G with the following protein sources: casein (CAS) used as the control, whey protein (WP) and whey protein hydrolysate (WPH). The exercised animals were submitted to a single exercise session for 60 min at 15m/min one day prior to euthanasia. After the experimental period, the animals were euthanized, and the muscle glucose transporters GLUT-1 and GLUT-4 analyzed by western blot. In addition, glycogen, free plasma amino acids, insulin and the biochemical health indicators were analyzed by standard techniques. The consumption of WPH significantly increased the concentrations of GLUT-4 in the PM and of glycogen, whereas GLUT-1, insulin and the health indicators remained unaltered. Based on evidence from experiment 1 that the consumption of WPH raised the muscle glycogen reserves and also the concentration of the glucose transporter GLUT-4 in the plasma membrane, the second experiment was designed to identify which WPH components could modulate translocation of the glucose transporter GLUT-4 to the PM in the skeletal muscle of the animals. Forty-nine male Wistar rats were used, divided into 7 groups (n=7), who were orally fed 30% glucose solutions plus 0.55 g/kg of body weight of the following WPH components: a) glucose (control); b) WPH; c) L-isoleucine; d) L-leucine; e) L-leucine plus L-isoleucine (50:50 mixture of both amino acids); f) L-isoleucyl-L-leucine peptide or g) L-leucyl-L-isoleucine peptide. After receiving the solutions, the animals were euthanized and the GLUT-4 determined by western blot. Glycogen, glycemia, insulin, free plasma and muscle amino acids, and the biochemical health indicators were also analyzed by classical methods. Of the WPH components tested, the peptide L-leucyl-L-isoleucine and the amino acid L-isoleucine were shown to be more efficient in translocating GLUT-4 to the PM, favoring the capture of glucose by the skeletal muscle. The results obtained from these experiments indicated that the consumption of WPH and its components increased GLUT-4 translocation to the plasma membrane, and could aid in the treatment and prevention of type ll diabetes / Doutorado / Nutrição Experimental e Aplicada à Tecnologia de Alimentos / Doutora em Alimentos e Nutrição

京都大学 / 0048 / 新制・課程博士 / 博士(農学) / 甲第19048号 / 農博第2126号 / 新制||農||1032(附属図書館) / 学位論文||H27||N4930(農学部図書室) / 31999 / 京都大学大学院農学研究科応用生命科学専攻 / (主査)教授 植田 充美, 教授 植田 和光, 教授 小川 順 / 学位規則第4条第1項該当 / Doctor of Agricultural Science / Kyoto University / DFAM

Enzimas proteolíticas são comumente empregadas na liberação de peptídeos bioativos com potencial aplicabilidade como aditivos em alimentos. Neste trabalho, estudou-se a capacidade de inibição do escurecimento de maçãs minimamente processadas do soro de leite de búfala hidrolisado por Alcalase em diferentes intervalos, ti (i = 0 h, 0,5 h, 1 h, 2 h, 3 h, 4 h ou 6 h). O processo de hidrólise foi acompanhado por determinação do grau de hidrólise (GH). Para se entender possíveis modos de ação sobre o escurecimento enzimático, o soro, ao longo do tempo de hidrólise, foi submetido às análises de capacidade capacidade antioxidante (capacidade de sequestro do radical ABTS•+, atividade quelante de Fe2+ e poder redutor), reatividade com quinonas e atividade inibitória sobre polifenoloxidases (PFO) extraídas de maçãs Red Delicious. Após os ensaios in vitro, o hidrolisado t4h foi testado quanto à capacidade de inibição do escurecimento de maçãs Red Delicious minimamente processadas, determinada por meio de análises de luminosidade (parâmetro L*) e índice de escurecimento (IE). O soro apresentou aumento significativo (p < 0,05) do GH, da atividade antioxidante, da reatividade com quinonas e da atividade inibitória de PFO em função do tempo de hidrólise. Especificamente para a atividade inibitória de PFO, o hidrolisado t4h alcançou pico de inibição próximo de 50 %. Quanto à capacidade de inibição do escurecimento das maçãs minimamente processadas, o hidrolisado manteve o parâmetro L* das maçãs durante 6 dias de armazenamento, não diferindo significativamente (p > 0,05) do metabissulfito. Além da luminosidade, o soro de leite hidrolisado conseguiu manter melhor o IE das maçãs durante esse tempo de armazenamento, comparativamente ao soro não hidrolisado (p < 0,05). Esses resultados evidenciam informações sobre possíveis aplicações de soro de leite bubalino hidrolisado com Alcalase como substituto natural de aditivos convencionalmente utilizados no controle desse tipo de escurecimento em alimentos. / Proteolytic enzymes are commonly employed in the release of bioactive peptides with potential applicability in food additives. In this work, the ability to inhibit the browning of minimally processed apples from Alcalase hydrolysed buffalo whey at different time, ti (i = 0 h, 0.5 h, 1 h, 2 h, 3 h, 4 h or 6 h). The hydrolysis process was followed by determination of the degree of hydrolysis (DH). In order to understand possible modes of action on the enzymatic browning, the whey was submitted to the analysis of the antioxidant capacity (capacity of sequestration of the ABTS•+ radical, Fe2+ chelating activity and reducing power), reactivity with quinones and inhibitory activity on polyphenoloxidases (PPO) extracted from Red Delicious apples. Following the in vitro assays, the t4h hydrolyzate was tested for the ability to inhibit the browning of minimally processed Red Delicious apples, determined by means of analysis of luminosity (parameter L *) and browning index (BI). Buffalo whey shows significant increase (p < 0.05) in DH, antioxidant activity, reactivity with quinones and PPO inhibitory activity as a function of the hydrolysis time. Specifically for the PPO inhibitory activity, the t4h hydrolyzate reached a near 50% inhibition peak. As for the ability to inhibit the browning of the minimally processed apples, the hydrolyzate kept the L * parameter of the apples during 6 days of storage, not statistically differing (p > 0.05) from the metabisulfite. In addition to the luminosity, the hydrolyzed whey was able to maintain the IE of the apples better during this storage time, compared to the unhydrolyzed whey (p < 0.05). These results evidenced information on possible applications of hydrolysed buffalo whey with Alcalase as a natural substitute for additives conventionally used in the control of this type of browning in foods.

Peptídeos bioativos são de grande interesse tanto para a indústria farmacêutica como para a de alimentos e são obtidos a partir da hidrólise enzimática de várias fontes protéicas, como as do leite, glúten de milho, soja, e músculos de suínos, aves e peixes. Estes peptídeos podem desempenhar atividades benéficas para a saúde, entre elas, a regulação ou inibição de enzimas, com destaque à inibição da enzima conversora da angiotensina I (ECA). Esta enzima é responsável pela clivagem de dois importantes substratos envolvidos na regulação da pressão arterial, a angiotensina I e a bradicinina. Neste trabalho foi estudada a atividade inibitória da ECA em hidrolisados dos peixes tilápia tailandesa (Oreochromis niloticus - linhagem tailandesa) e corvina (Micropogonias furnien) . Os \"minced\" destes peixes foram hidrolisados com pepsina e proteases de Streptomyces griséus por 5 horas em condições ideais de pH e temperatura. A atividade inibitória foi avaliada pela medida da atividade residual da enzima sobre substrato sintético fluorescente. Os hidrolisados com um grau de hidrólise de cerca de 34% apresentaram atividade inibitória semelhante, com valor de IC50 = 0,040 e 0,036 mg proteína/mL, respectivamente para a tilápia e a corvina. Observou-se aumento da atividade inibitória com o progresso da hidrólise, sendo que este aumento também está relacionado com a especificidade das enzimas proteolíticas. Em outro experimento observou-se que os peptídeos presentes no hidrolisado de tilápia inibiram indistintamente os domínios C e N terminais da ECA, não demonstrando especificidade. A atividade inibitória dos hidrolisados foi mantida após submetê-los à ação de enzimas proteolíticas gastrointestinais, indicando a sua provável estabilidade \"in vivo\". Da mesma forma, o minced de tilápia quando incubado sucessivamente com pepsina/tripsina/quimotripsina produziu peptídeos ativos (IC50 = O,025mg proteína/mL). Apesar do reduzido grau de hidrólise obtido neste ensaio (17%), os peptídeos liberados apresentaram atividade inibitória elevada, confirmando que a atividade não está relacionada apenas com o grau de hidrólise, mas também com a sequência de aminoácidos, liberados em função da especificidade das enzimas. Concluiu-se que o consumo destes peixes, ou seus respectivos hidrolisados poderá eventualmente, auxiliar na prevenção e no tratamento não medicamentoso da hipertensão, embora estudos \"in vivo\" sejam necessários para comprovar as suas funções biológicas. / Bioactive peptides have been highly valued by pharmaceutical industries and by food industries as well. These peptides can be released by the enzymatic hydrolysis of various protein sources such as milk, com gluten, soybean, muscles of pigs, chicken and fish and have been recognized to exhibit important health benefits. Among these, the regulation or inhibition of enzymes, like the inhibition of the angiotensin I-converting enzyme (ACE) have been focused. This enzyme is responsible for the cleavage of two important substrates, angiotensin I and bradykinin, both of them involved with the regulation of blood pressure. In this study the inhibitory activity of hydrolysates from tilapia tailandesa (Oreochromis niloficus - linhagem tailandesa) and corvina (Micropogonias furnien) was evaluated. The hydrolysates of the minced fishes were produced in a 5-hour lasting controlled process under optimal conditions of pH and temperature by the sequential action of pepsin and enzymes from Streptomyces griseus. Inhibitory activity was evaluated by measuring the residual activity of the enzyme on a synthetic fluorescent peptidic substrate. The extent of hydrolysis was about 34% and the hydrolysates of tilapia and corvine showed similar inhibitory activity (IC50 of 0.040 and 0.036 mg protein/mL), respectively. An íncrease of activity proportional to the degree of hydrolysis was observed, as well as a relationship with the specificity of the enzymes used. In another experiment it was observed that the bioactive peptides present in the hydrolysate of tilapia did not show specificity for the C- and N-terminal catalytic domains of the angiotensin I-converting enzyme. The inhibitory activity of the hydrolysates was still active afier a further hydrolysis by gastrointestinal enzymes, which seems to indicate an eventual activity in vivo. In a similar way, when the minced tilapia was consecutively incubated with pepsine, trypsin, chymotrypsin active peptides were produced with an activity of IC50 = 0.025 mg protein/mL. Despite the low extend of hydrolysis of about 17%, a high inhibitory activity was observed confirming that activity is not only related to the degree of hydrolysis but also to the sequence of aminoacids and therefore, to the specificity of the enzymes as well. It was concluded that the intake of fish or fish hydrolysates has the potential to help control or to prevent hypertension by a non-drug food-based treatment.

Als Schlüsselenzym im Renin-Angiotensin System übernimmt das Angiotensin Converting Enzyme (ACE) eine wichtige Rolle bei der Blutdruckregulierung. ACE spaltet das biologisch inaktive Angiotensin I zum vasokonstriktorisch wirksamen Angiotensin II, was zu einem Anstieg des Blutdruckes führt. Tier- und Humanstudien zeigten, dass die Aufnahme bekannter, aus dem Proteinabbau stammender ACE-Inhibitoren eine Absenkung des Blutdruckes bewirkte. In der Lebensmittelindustrie finden Hydrolysate von Milchproteinen, im speziellen von Molkenproteinen, Einsatz in hypoallergenen (HA) Säuglingsnahrungen. Obwohl das Phänomen einer ACE-Inhibierung durch HA-Nahrungen in vitro in der Literatur bereits Erwähnung fand, existieren bislang keine Angaben zu einer potentiellen Wirkung in vivo. In der vorliegenden Arbeit konnte für kommerzielle hypoallergene (HA) Säuglingsnahrung eine sehr starke ACE-Hemmung in vitro zeigen (IC50-Werte zwischen 20 und 104 mg Protein/liter), welche die für fermentierte Sauermilchprodukte dokumentierte Wirkung bei weitem überstieg.] Mittels RP-HPLC und ESI-TOF-MS konnte neben zahlreichen bekannten Peptiden mit ACE-hemmendem Effekt erstmals das aus der Primärsequenz von -Lactalbumin freigesetzte Dipeptid Ile-Trp in den HA-Nahrungen identifiziert und quantifiziert werden. Ile-Trp ist der bislang potenteste in Lebensmitteln nachgewiesene ACE-Inhibitor (IC50 = 0,7µM). HA-Nahrungen zeigten auch ex vivo im Zellsystem (HUVECs) einen stark ACE-hemmenden Effekt. Aus diesem Grunde wurde ein möglicher Einfluss der HA-Nahrungen auf den Blutdruck spontan hypertensiver Ratten untersucht. Hierfür wurden die Tiere im Rahmen einer Fütterungsstudie über 14 Wochen mit standardisiertem Futter, welchem HA-Nahrung (Gruppe 1), konventionelle Säuglingsnahrung (Gruppe 2) bzw. der bekannte ACE-Inhibitor Captopril (Gruppe 3) zugesetzt war, gefüttert. Eine vierte Gruppe mit Standardfutter diente als Kontrolle. Der Blutdruck wurde am wachen Tier nichtinvasiv mittels tail-cuff-Methode gemessen. Der systolische Blutdruck sank bei Verabreichung der HA-Nahrung nach 7 Wochen signifikant um 21 ± 8 mmHg ab im Vergleich zur Kontrollgruppe bzw. den mit konventioneller Säuglingsnahrung gefütterten Tieren. Captopril führte zur einer Blutdrucksenkung um 30 ± 7 mmHg.

Enzimas proteolíticas são comumente empregadas na liberação de peptídeos bioativos com potencial aplicabilidade como aditivos em alimentos. Neste trabalho, estudou-se a capacidade de inibição do escurecimento de maçãs minimamente processadas do soro de leite de búfala hidrolisado por Alcalase em diferentes intervalos, ti (i = 0 h, 0,5 h, 1 h, 2 h, 3 h, 4 h ou 6 h). O processo de hidrólise foi acompanhado por determinação do grau de hidrólise (GH). Para se entender possíveis modos de ação sobre o escurecimento enzimático, o soro, ao longo do tempo de hidrólise, foi submetido às análises de capacidade capacidade antioxidante (capacidade de sequestro do radical ABTS•+, atividade quelante de Fe2+ e poder redutor), reatividade com quinonas e atividade inibitória sobre polifenoloxidases (PFO) extraídas de maçãs Red Delicious. Após os ensaios in vitro, o hidrolisado t4h foi testado quanto à capacidade de inibição do escurecimento de maçãs Red Delicious minimamente processadas, determinada por meio de análises de luminosidade (parâmetro L*) e índice de escurecimento (IE). O soro apresentou aumento significativo (p < 0,05) do GH, da atividade antioxidante, da reatividade com quinonas e da atividade inibitória de PFO em função do tempo de hidrólise. Especificamente para a atividade inibitória de PFO, o hidrolisado t4h alcançou pico de inibição próximo de 50 %. Quanto à capacidade de inibição do escurecimento das maçãs minimamente processadas, o hidrolisado manteve o parâmetro L* das maçãs durante 6 dias de armazenamento, não diferindo significativamente (p > 0,05) do metabissulfito. Além da luminosidade, o soro de leite hidrolisado conseguiu manter melhor o IE das maçãs durante esse tempo de armazenamento, comparativamente ao soro não hidrolisado (p < 0,05). Esses resultados evidenciam informações sobre possíveis aplicações de soro de leite bubalino hidrolisado com Alcalase como substituto natural de aditivos convencionalmente utilizados no controle desse tipo de escurecimento em alimentos. / Proteolytic enzymes are commonly employed in the release of bioactive peptides with potential applicability in food additives. In this work, the ability to inhibit the browning of minimally processed apples from Alcalase hydrolysed buffalo whey at different time, ti (i = 0 h, 0.5 h, 1 h, 2 h, 3 h, 4 h or 6 h). The hydrolysis process was followed by determination of the degree of hydrolysis (DH). In order to understand possible modes of action on the enzymatic browning, the whey was submitted to the analysis of the antioxidant capacity (capacity of sequestration of the ABTS•+ radical, Fe2+ chelating activity and reducing power), reactivity with quinones and inhibitory activity on polyphenoloxidases (PPO) extracted from Red Delicious apples. Following the in vitro assays, the t4h hydrolyzate was tested for the ability to inhibit the browning of minimally processed Red Delicious apples, determined by means of analysis of luminosity (parameter L *) and browning index (BI). Buffalo whey shows significant increase (p < 0.05) in DH, antioxidant activity, reactivity with quinones and PPO inhibitory activity as a function of the hydrolysis time. Specifically for the PPO inhibitory activity, the t4h hydrolyzate reached a near 50% inhibition peak. As for the ability to inhibit the browning of the minimally processed apples, the hydrolyzate kept the L * parameter of the apples during 6 days of storage, not statistically differing (p > 0.05) from the metabisulfite. In addition to the luminosity, the hydrolyzed whey was able to maintain the IE of the apples better during this storage time, compared to the unhydrolyzed whey (p < 0.05). These results evidenced information on possible applications of hydrolysed buffalo whey with Alcalase as a natural substitute for additives conventionally used in the control of this type of browning in foods.

Enzimas proteolíticas são comumente empregadas na liberação de peptídeos bioativos com potencial aplicabilidade como aditivos em alimentos. Neste trabalho, estudou-se a capacidade de inibição do escurecimento de maçãs minimamente processadas do soro de leite de búfala hidrolisado por Alcalase em diferentes intervalos, ti (i = 0 h, 0,5 h, 1 h, 2 h, 3 h, 4 h ou 6 h). O processo de hidrólise foi acompanhado por determinação do grau de hidrólise (GH). Para se entender possíveis modos de ação sobre o escurecimento enzimático, o soro, ao longo do tempo de hidrólise, foi submetido às análises de capacidade capacidade antioxidante (capacidade de sequestro do radical ABTS•+, atividade quelante de Fe2+ e poder redutor), reatividade com quinonas e atividade inibitória sobre polifenoloxidases (PFO) extraídas de maçãs Red Delicious. Após os ensaios in vitro, o hidrolisado t4h foi testado quanto à capacidade de inibição do escurecimento de maçãs Red Delicious minimamente processadas, determinada por meio de análises de luminosidade (parâmetro L*) e índice de escurecimento (IE). O soro apresentou aumento significativo (p < 0,05) do GH, da atividade antioxidante, da reatividade com quinonas e da atividade inibitória de PFO em função do tempo de hidrólise. Especificamente para a atividade inibitória de PFO, o hidrolisado t4h alcançou pico de inibição próximo de 50 %. Quanto à capacidade de inibição do escurecimento das maçãs minimamente processadas, o hidrolisado manteve o parâmetro L* das maçãs durante 6 dias de armazenamento, não diferindo significativamente (p > 0,05) do metabissulfito. Além da luminosidade, o soro de leite hidrolisado conseguiu manter melhor o IE das maçãs durante esse tempo de armazenamento, comparativamente ao soro não hidrolisado (p < 0,05). Esses resultados evidenciam informações sobre possíveis aplicações de soro de leite bubalino hidrolisado com Alcalase como substituto natural de aditivos convencionalmente utilizados no controle desse tipo de escurecimento em alimentos. / Proteolytic enzymes are commonly employed in the release of bioactive peptides with potential applicability in food additives. In this work, the ability to inhibit the browning of minimally processed apples from Alcalase hydrolysed buffalo whey at different time, ti (i = 0 h, 0.5 h, 1 h, 2 h, 3 h, 4 h or 6 h). The hydrolysis process was followed by determination of the degree of hydrolysis (DH). In order to understand possible modes of action on the enzymatic browning, the whey was submitted to the analysis of the antioxidant capacity (capacity of sequestration of the ABTS•+ radical, Fe2+ chelating activity and reducing power), reactivity with quinones and inhibitory activity on polyphenoloxidases (PPO) extracted from Red Delicious apples. Following the in vitro assays, the t4h hydrolyzate was tested for the ability to inhibit the browning of minimally processed Red Delicious apples, determined by means of analysis of luminosity (parameter L *) and browning index (BI). Buffalo whey shows significant increase (p < 0.05) in DH, antioxidant activity, reactivity with quinones and PPO inhibitory activity as a function of the hydrolysis time. Specifically for the PPO inhibitory activity, the t4h hydrolyzate reached a near 50% inhibition peak. As for the ability to inhibit the browning of the minimally processed apples, the hydrolyzate kept the L * parameter of the apples during 6 days of storage, not statistically differing (p > 0.05) from the metabisulfite. In addition to the luminosity, the hydrolyzed whey was able to maintain the IE of the apples better during this storage time, compared to the unhydrolyzed whey (p < 0.05). These results evidenced information on possible applications of hydrolysed buffalo whey with Alcalase as a natural substitute for additives conventionally used in the control of this type of browning in foods.

Made available in DSpace on 2014-07-29T15:12:46Z (GMT). No. of bitstreams: 1 Dissertacao Quimica Eliane S F Alves.pdf: 4161656 bytes, checksum: 36361e76b0e7ad73aea61043645102f1 (MD5) Previous issue date: 2012-02-24 / Currently, the emergence of fungi, bacteria and viruses resistant to multiple drugs has stimulated interest in the development of antimicrobial peptides with increased therapeutic potential. They generally have properties of extreme importance as antimicrobial selective toxicity, rapid action, specific mechanisms of action and a broad spectrum of antimicrobial action. Many of these features can be found in peptides isolated from frog skin secretions. The main factor that differentiates antimicrobial peptides from other commonly antibiotics used in the conventional therapy is related to their mechanism of action. The driving force for much of the action of antimicrobial peptides is their ability to lysis cell membranes, rapidly killing a broad spectrum of microorganisms. Accordingly, the conformation of the peptide has a great importance in their interaction with the amphiphilic structure of biological membranes. The determination of the tridimensional structure by Nuclear Magnetic Resonance (NMR) technique allows the identification of the spatial position of each amino acid residue and highlighting those that are important for its action and, therefore, could be modified to increase the antimicrobial activity. The study of the three-dimensional structure of peptides in solution is an advantage of the NMR spectroscopy, since it can simulate the physiological environment, by means of surfactants. In this context, the tridimensional structures of two synthetic peptides: ocellatin-P1G16 (GLLDTLKGAAKNVVGGLASKVMEKL-NH2), isolated from the amphibians Leptodactylus labyrinthicus, and hylin a1 (IFGAILPLALGALKNLIK-NH2), isolated from Hypsiboas Albopunctatus, were proposed by NMR. The amphipathic caracter can be visualized by separation of the helix into two distinct sides, one hydrophobic (nonpolar) and the other hydrophilic (polar). The peptide hylin a1 in presence of SDS-d25 showed helical structure between residues Ile-5 to Ile-17 and the peptide ocellatin-P1G16 in SDS-d25 micelles showed a &#945;-helical structure between residues Leu-3 to Lys-24, both are presented in amphipathic &#945;-helix Finally, the molecular analyses of amphipathicity, electrostatic interaction, polarity and exchange hydrogen/deuterium, corroborate the proposed model, suggesting a model of parallel orientation to the peptide hylin a1 and the peptide ocellatin-P1G16 a parallel orientation, but with the cterminal portion immersed in the micelle SDS-d25 between residues Ser-19 to Leu-25, as observed by analyzing exchange hydrogen/deuterium. These structural characteristics make these peptides promising candidates for the development of a new antimicrobial drug. / Atualmente o surgimento de fungos, bactérias e vírus resistentes a múltiplos fármacos tem estimulado o interesse pelo desenvolvimento de peptídeos antimicrobianos com maior potencial terapêutico. Eles em geral possuem propriedades de extrema importância como um amplo espetro ação antimicrobiana, toxicidade seletiva, ação rápida e mecanismos de ação específicos. Muitas dessas características podem ser encontradas em peptídeos isolados da secreção cutânea de anuros. O principal fator que diferencia peptídeos antimicrobianos de antibióticos utilizados na terapia convencional está relacionado com o seu mecanismo de ação. A força motriz para a ação de grande parte de peptídeos antimicrobianos é sua habilidade em provocar lise em membranas celulares, matando rapidamente um amplo espectro de microorganismos. Nesse sentido, a conformação do peptídeo tem uma grande importância em sua interação com a estrutura anfifílica das membranas biológicas. Nesse contexto, a determinação da estrutura tridimensional por meio da espectroscopia de Ressonância Magnética Nuclear (RMN) possibilita a identificação da posição espacial de cada resíduo de aminoácido na estrutura terciaria, destacando aqueles que são importantes para a sua ação e que, portanto, poderiam ser modificados para aumentar a atividade antimicrobiana. O estudo da estrutura 3D dos peptídeos em soluçao é uma vantagem da espectroscopia de RMN, pois se consegue simular o ambiente fisiológico por meio de sulfactantes. Nesse contexto, determinou-se através da RMN a estrutura tridimensional de dois peptídeos sintéticos: ocellatina-P1G16 (GLLDTLKGAAKNVVGGLASKVMEKL-NH2) isolado dos anfíbios Leptodactylus labyrinthicus, e o peptídeo hilina a1 (IFGAILPLALGALKNLIKNH2), isolado do anfíbio Hypsiboas albopunctatus. A anfipaticidade da estrutura pode ser observada pela separação da estrutura em duas faces distintas, uma hidrofobica (apolar) e outra hidrofilica (polar). O peptídeo hilina a1, em presença de SDS-d25, apresentou estrutura helicoidal entre os resíduos Ile-5 a Ile-17 e o peptídeo ocellatina-P1G16, em presença de SDS-d25, apresentou estrutura em &#945;-hélice entre os resíduos Leu-3 a Lys-24, ambos em &#945;-hélice anfipática. Por fim, as análises moleculares de anfipaticidade, interação eletrostática, polaridade e troca H2O/D2O, apontaram a mesma face de interação dos peptídeos com a membrana, propondo um modelo de orientação paralela para o peptídeo hilina a1 e para o peptídeo ocellatina- P1G16 uma orientação paralela, porém com a porção c-terminal mergulhada na micela de SDS-d25 entre os resíduos Ser-19 e Leu-25. Tais características estruturais tornam esses peptídeos candidatos promissores para o desenvolvimento de um novo fármaco antimicrobiano.

Parmi 30 souches, seule 4F44 excrète une activité dans son milieu de culture qui ne résulte pas de la présence de protéases intracellulaires due à une lyse cellulaire.D’après le séquençage N-ter, l’enzyme soluble chez 4F44 est PrtS retrouvée sous deux formes (non mature et mature) à la fois ancrée (60%) et soluble (40%).Sa séquence protéique déduite de prtS est proche de celles de LMD-9 (97% identité), CNRZ385 (98%), JIM8232 (96%) et S. suis (97%) chez qui elle est toujours ancrée. Le domaine d’ancrage contenant LPNTG est conservé chez 4F44, LMD-9, CNRZ385 et S. suis ; ainsi elle serait ancrée au peptidoglycane par la sortase A (SrtA). Chez 4F44, l’absence d’une duplication peptidique imparfaite dans le prodomaine de PrtS pourrait expliquer sa libération partielle, en effet LMD-9 présentant cette duplication possède sa protéase PrtS uniquement sous forme ancrée.La comparaison de la séquence de la sortase déduite du gène de 4F44, ND03, LMD-9, PB18O, PB302 et CNRZ307 a montré que les sites catalytique et actif sont conservés. Seuls 6 résidus d’acides aminés sont différents, la substitution chez 4F44 de I222 par V222 entraînerait sa libération partielle. Les peptides trypsiques C-ter QVTQLPNTGENDTK et QVTQLPNTGENDTKYYLVPGVIIGLGTLLVSIRR ont été identifiés en MS/MS, donc la liaison TG (cible de l’activité peptidasique de SrtA) n’est pas hydrolysée. La caséine β est la caséine préférentiellement hydrolysée. L’enzyme présente une large spécificité de coupure (A, L, M, F, Y, W, V, S, T, N, Q, R, H et K en position P1). Globalement elle libère 33 peptides bioactifs : ECA-inhibiteurs, mitogènes, opioïdes, immunomodulants, antibactériens, antioxydants, antimutagènes / Among 30 strains, only 4F44 strain releases a activity in the medium which does not results from the presence of intracellular protease due to cell lysis. This soluble protease is PrtS in two forms (non mature and mature), 60% as anchored to cell wall and 40% as released in the medium. The protein sequence deduced from the gene is slightly different to those of LMD-9 (97% identity), CNRZ385 (98%), JIM8232 (96%), S. suis (97%). The protein sequence of the anchor domain including LPNTG is conserved as for LMD-9, CNRZ385 and S. suis ; so this PrtS might be anchored to peptidoglycan by sortase A (SrtA).In 4F44, the absence of an imperfect duplication of a peptide sequence at prodomain of PrtS could explain the partial liberation, furthermore, the LMD-9 strain which presents this duplication possess the protease PrtS only the anchored form.Comparison of protein sequence deduced from the srtA gene in 4F44, ND03, LMD-9, PB18O, PB302 and CNRZ307 strains showed that the residues of the catalytic and active sites are conserved. Six amino acids are different for 4F44, I222 replaced by a V222 possibly leads to the partial liberation of PrtS. The trypsic C-ter peptides QVTQLPNTGENDTK and QVTQLPNTGENDTKYYLVPGVIIGLGTLLVSIRR have been identified by MS/MS, indicating that the peptide bond of T and G (target of endopeptidasic activity of Srt A) is not hydrolyzed.β-casein is preferentially degraded in comparison to other caseins. Soluble PrtS has a broad specificity against A, L, M, F, Y, W, V, S, T, N, Q, R, H and K at position P1. Globally, it releases 33 bioactive peptides (antihypertensives, mitogenics, oipoide, immunomodulantors, antimicrobials, antioxydants, antimutagens)

Peptídeos bioativos são de grande interesse tanto para a indústria farmacêutica como para a de alimentos e são obtidos a partir da hidrólise enzimática de várias fontes protéicas, como as do leite, glúten de milho, soja, e músculos de suínos, aves e peixes. Estes peptídeos podem desempenhar atividades benéficas para a saúde, entre elas, a regulação ou inibição de enzimas, com destaque à inibição da enzima conversora da angiotensina I (ECA). Esta enzima é responsável pela clivagem de dois importantes substratos envolvidos na regulação da pressão arterial, a angiotensina I e a bradicinina. Neste trabalho foi estudada a atividade inibitória da ECA em hidrolisados dos peixes tilápia tailandesa (Oreochromis niloticus - linhagem tailandesa) e corvina (Micropogonias furnien) . Os \"minced\" destes peixes foram hidrolisados com pepsina e proteases de Streptomyces griséus por 5 horas em condições ideais de pH e temperatura. A atividade inibitória foi avaliada pela medida da atividade residual da enzima sobre substrato sintético fluorescente. Os hidrolisados com um grau de hidrólise de cerca de 34% apresentaram atividade inibitória semelhante, com valor de IC50 = 0,040 e 0,036 mg proteína/mL, respectivamente para a tilápia e a corvina. Observou-se aumento da atividade inibitória com o progresso da hidrólise, sendo que este aumento também está relacionado com a especificidade das enzimas proteolíticas. Em outro experimento observou-se que os peptídeos presentes no hidrolisado de tilápia inibiram indistintamente os domínios C e N terminais da ECA, não demonstrando especificidade. A atividade inibitória dos hidrolisados foi mantida após submetê-los à ação de enzimas proteolíticas gastrointestinais, indicando a sua provável estabilidade \"in vivo\". Da mesma forma, o minced de tilápia quando incubado sucessivamente com pepsina/tripsina/quimotripsina produziu peptídeos ativos (IC50 = O,025mg proteína/mL). Apesar do reduzido grau de hidrólise obtido neste ensaio (17%), os peptídeos liberados apresentaram atividade inibitória elevada, confirmando que a atividade não está relacionada apenas com o grau de hidrólise, mas também com a sequência de aminoácidos, liberados em função da especificidade das enzimas. Concluiu-se que o consumo destes peixes, ou seus respectivos hidrolisados poderá eventualmente, auxiliar na prevenção e no tratamento não medicamentoso da hipertensão, embora estudos \"in vivo\" sejam necessários para comprovar as suas funções biológicas. / Bioactive peptides have been highly valued by pharmaceutical industries and by food industries as well. These peptides can be released by the enzymatic hydrolysis of various protein sources such as milk, com gluten, soybean, muscles of pigs, chicken and fish and have been recognized to exhibit important health benefits. Among these, the regulation or inhibition of enzymes, like the inhibition of the angiotensin I-converting enzyme (ACE) have been focused. This enzyme is responsible for the cleavage of two important substrates, angiotensin I and bradykinin, both of them involved with the regulation of blood pressure. In this study the inhibitory activity of hydrolysates from tilapia tailandesa (Oreochromis niloficus - linhagem tailandesa) and corvina (Micropogonias furnien) was evaluated. The hydrolysates of the minced fishes were produced in a 5-hour lasting controlled process under optimal conditions of pH and temperature by the sequential action of pepsin and enzymes from Streptomyces griseus. Inhibitory activity was evaluated by measuring the residual activity of the enzyme on a synthetic fluorescent peptidic substrate. The extent of hydrolysis was about 34% and the hydrolysates of tilapia and corvine showed similar inhibitory activity (IC50 of 0.040 and 0.036 mg protein/mL), respectively. An íncrease of activity proportional to the degree of hydrolysis was observed, as well as a relationship with the specificity of the enzymes used. In another experiment it was observed that the bioactive peptides present in the hydrolysate of tilapia did not show specificity for the C- and N-terminal catalytic domains of the angiotensin I-converting enzyme. The inhibitory activity of the hydrolysates was still active afier a further hydrolysis by gastrointestinal enzymes, which seems to indicate an eventual activity in vivo. In a similar way, when the minced tilapia was consecutively incubated with pepsine, trypsin, chymotrypsin active peptides were produced with an activity of IC50 = 0.025 mg protein/mL. Despite the low extend of hydrolysis of about 17%, a high inhibitory activity was observed confirming that activity is not only related to the degree of hydrolysis but also to the sequence of aminoacids and therefore, to the specificity of the enzymes as well. It was concluded that the intake of fish or fish hydrolysates has the potential to help control or to prevent hypertension by a non-drug food-based treatment.