Submitted by Reginaldo Soares de Freitas (reginaldo.freitas@ufv.br) on 2017-02-10T10:24:21Z No. of bitstreams: 1 texto completo.pdf: 4520555 bytes, checksum: fe8d3a2da8cd19ec1afdfb3b0e97134e (MD5) / Made available in DSpace on 2017-02-10T10:24:21Z (GMT). No. of bitstreams: 1 texto completo.pdf: 4520555 bytes, checksum: fe8d3a2da8cd19ec1afdfb3b0e97134e (MD5) Previous issue date: 2016-07-25 / Coordenação de Aperfeiçoamento de Pessoal de Nível Superior / A mineração de dados (DM, do inglês data mining) é um processo de des- coberta de padrões que permite extrair informação e conhecimento em grandes volumes de dados. Suas principais técnicas se baseiam em predição, classificação e agrupamento (clustering). Estas técnicas têm sido utilizadas na bioinformá- tica para classificar o perfil de expressão gênica, encontrar padrões em sequências de DNA, avaliar a estrutura do dobramento de proteínas, entre outras aplicações. Neste trabalho, avançadas técnicas de DM foram aplicadas para o desenvolvimento de um Data Warehouse específica para geminivírus (geminivirus.org), a fim de au- xiliar na organização, correção e normalização de dados referentes a geminivírus. Neste Data Warehouse também foram propostas metodologias baseadas em regras e aprendizado de máquina (ML) que classificam as sequências de DNA e seus ge- nes. A família Geminiviridae é composta por pequenos vírus de DNA circular de fita simples que infectam uma grande variedade de plantas e causam sérios danos econômicos ao redor do mundo. O aprimoramento da amplificação do DNA viral e de técnicas de sequenciamento permitiram um enorme crescimento de dados em banco de dados públicos. Simultaneamente, ocorreu o crescimento no volume de publicações relacionadas a esta família. Desta forma, numa segunda linha de tra- balho surgiu a necessidade de aplicar as técnicas de DM, seguindo o processo de KDD (knowledge-discovery in databases) para extrair informações desses dados. Além disso, técnicas de Processamento de Linguagem Natural (NLP) foram utili- zadas para extrair informação em resumos de artigos relacionados a geminivírus. Assim, o acervo científico pode ser explorado de maneira contextualizada. Final- mente, uma terceira frente de trabalho em mineração de dados foi empreendida, desta vez direcionada à descoberta de proteínas ribossomais. Pesquisas recentes têm demonstrado que plantas suprimem o mecanismo global de tradução como uma estratégia de imunidade antiviral. Entretanto, poucas proteínas ribossomais são mencionadas a integrarem vias do mecanismo de defesa das plantas. As pro- teínas ribossomais (RPs) desempenham um papel fundamental em células vivas, pois são o principal componente dos ribossomos. Além disso, estas proteínas estão envolvidas em vários processos fisiológicos e patológicos. Assim, foi desenvolvido um método de aprendizado de máquina capaz de identificar novas proteínas ri- bossomais, designado Rama. O Rama utiliza abordagens inovadoras em relação aos métodos computacionais atualmente existentes. Em experimentos in silico, o Rama obteve resultados médios de precisão, acurácia, sensitividade e especifici- dade de 0.9203, 0.9214, 0.9214 e 0.8236, respectivamente. Ademais, duas proteínas não caracterizadas foram preditas como RPs pelo Rama e experimentos in vitro confirmaram a veracidade do resultado, ao passo que as metodologias atuais não conseguem lograr o mesmo sucesso. / Data mining (DM) is a pattern discovery process that can extract information and knowledge in large volumes of data. Its main techniques are based on prediction, classification, and clustering. These techniques have been used in bioinformatics to identify gene expression profiles, find patterns in DNA sequences, evaluate protein folding structure, among other applications. In this work, advanced techniques of DM were applied to the development of a specific Data Warehouse for geminivi- ruses (geminivirus.org) to assist in organization, correction, and normalization of data related to geminivirus. In this Data Warehouse, we also propose methodo- logies based on rules and machine learning (ML) to classify DNA sequences and their genes. The Geminiviridae family consists of small circular single-stranded DNA viruses which infect a wide variety of plants and cause serious economic losses wordwide. Improvements in amplification of viral DNA and sequencing techniques have led to an enormous growth of public databases. Thus, in a second endeavor in this work, we realized the need to apply DM techniques, following the process of KDD (knowledge-discovery in databases), to extract yet-unknown information. Furthermore, natural language processing techniques (NLP) were used to extract information in abstracts of paper related to geminivirus. In this way, the scientific literature can be explored in a contextualized manner. Finally, a third effort using data mining approaches was carried out, this time directed to the identification of new ribosomal proteins. Recent research has shown that plants suppress the ove- rall mechanism of translation as a strategy for antiviral immunity. However, few ribosomal proteins are referred to integrate pathways of plant defense mechanisms. Ribosomal proteins (RPs) have a fundamental role in living cells, as they are the main component of ribosomes. Furthermore, these proteins are involved in various physiological and pathological processes. Therefore, we developed a ML method to identify new ribosomal proteins, called Rama. Rama uses innovative approaches in comparison to currently existing computational methods. In in silico experiments, Rama presented average results of precision, accuracy, sensitivity, and specificity of 0.9203, 0.9214, 0.9214, and 0.8236, respectively. In addition, two proteins not yet characterized were predicted as RPs by Rama, whereas other methods could not achieve the same success. In vitro experiments confirmed the veracity of our result.

Submitted by Marco Antônio de Ramos Chagas (mchagas@ufv.br) on 2017-05-11T15:54:37Z No. of bitstreams: 1 texto completo.pdf: 1901797 bytes, checksum: e289fb49d5428280315e56aaa1136a67 (MD5) / Made available in DSpace on 2017-05-11T15:54:37Z (GMT). No. of bitstreams: 1 texto completo.pdf: 1901797 bytes, checksum: e289fb49d5428280315e56aaa1136a67 (MD5) Previous issue date: 2002-10-08 / Conselho Nacional de Desenvolvimento Científico e Tecnológico / A família Geminiviridae é uma família de vírus de planta constituída por vírus compostos por genoma circular de DNA fita simples que utilizam fatores do hospedeiro tanto para sua replicação quanto para a translocação do genoma viral no hospedeiro. Com a finalidade de identificar fatores do tomateiro que interagem com as proteínas virais do geminivírus TGMV (Tomato golden mosaic virus), foi utilizado o sistema duplo híbrido para escrutínio de proteínas positivas quanto à interação. As regiões codificadoras das proteínas MP, NSP e REn foram amplificadas e inseridas, individualmente, no vetor pBDGAL4 Cam, fusionadas ao domínio de ligação ao DNA do gene GAL4. Paralelamente foi construída uma biblioteca de cDNA de tomateiro, propagada em vetor de S. cerevisae derivados de lambda ZAPII. O escrutínio da biblioteca de cDNA assim como os ensaios funcionais de identificação de interação entre proteínas geminivirais foram conduzidos no sistema duplo-híbrido de leveduras. Ao contrário das proteínas MP e NSP, a proteína viral REn apresentou a capacidade de ativar a transcrição quando fusionada ao domínio de ligação ao DNA, o que impossibilitou seu uso como isca em ensaios de interação proteína-proteína por esse sistema. A expressão correta das proteínas de movimento MP e NSP, direcionada pelos vetores do sistema duplo-híbrido, foi comprovada pela capacidade das proteínas recombinantes em interagirem ativando os genes repórteres. A interação entre MP e NSP, identificada no presente trabalho, está coerente com os modelos propostos para movimento de geminivírus no hospedeiro, os quais sugerem a interação entre essas duas proteínas durante o processo de translocação do genoma viral. A proteína NSP foi então utilizada como isca nos ensaios de interação proteína-proteína, utilizando como alvo as proteínas codificadas pela biblioteca de cDNA de tomateiro. Como resultado do escrutínio da biblioteca de cDNA de tomateiro, foram identificados cinco cDNAs que codificam proteínas capazes de interagir com NSP com diferentes intensidades, conforme demonstrado em ensaios quantitativos da atividade do gene repórter β-galactosidase. A análise de seqüência e do padrão de restrição desses clones demonstraram que quatro deles eram idênticos e codificavam um domínio conservado de quinase serina/treonina, sendo denominado NIK (NSP - Interacting Kinase). Evidências indicam que, provavelmente, a interação entre NIK e NSP seja funcional. Análise da estrutura primária de NSP demonstrou a presença de resíduos de serina e treonina em contexto favorável para fosforilação. Além disso, NIK não foi capaz de interagir com outras proteínas virais e com controles, pelo sistema duplo híbrido, confirmando a especificidade da interação NSP-NIK. A análise comparativa da seqüência parcial do cDNA de NIK com seqüências de cDNAs de uma biblioteca de semente de soja mostrou que a proteina NIK possui cerca de 92% de similaridade de seqüência, na região carboxiterminal, com uma proteína quinase de soja. A quinase identificada em soja, denominada GmNIK (Glicine max NIK), contém 623 resíduos de aminoácidos e uma massa molecular estimada em 68586,10 kDa e foi capaz de interagir com NSP por meio do sistema duplo híbrido. GmNIK possui, além do domínio de quinase um domínio de ligação a ATP 309 419 IIHRDVKAANILL 431 , LGKGFGNVYKKGVFPDGTLVAVKK 332 , uma hélice transmembrana, provavelmente responsável pela inserção da proteína na 96 membrana plasmática, e regiões ricas em leucina, LTNQIVLLQNNNISGPIPSELGKLKLTQLDLSNNFFSGGIPPSLGHL 167 como 144 e 192 MTQLNFLDLSYNNLSGPVPRILAKS . Os domínios encontrados em GmNIK são característicos de proteínas codificadas por genes de resistência e de receptores de membrana envolvidos em programas de desenvolvimento. A predição do modelo topológico de GmNIK baseado em sua estrutura modular, similar `aquela da proteína codificada pelo gene de resistência Xa21, sugere a posição intracelular do domínio de quinase e do domínio de ligação a nucleotídeo, enquanto que as regiões ricas em leucina são voltadas para o meio extracelular. A posição intracelular do domínio de quinase está coerente com a hipótese de interação funcional entre GmNIK e NSP, uma vez que NSP localiza- se no meio celular interno. Ensaios adicionais deverão ser conduzidos para confirmar se a proteína viral NSP é fosforilada por NIK in vitro e in vivo. / Geminiviridae is a family of plant viruses comprised by viruses with a circular single stranded DNA genome that utilizes host factors for replication and viral genome translocation. In order to identify factors in tomato plants which interact with viral proteins of the geminivirus TGMV (Tomato golden mosaic virus), the yeast two-hybrid system was used to screen for proteins with a positive interaction. Coding regions of the proteins MP, NSP and REn were amplified and inserted, individually, within the vector pBDGAL4 Cam, and merged to the DNA binding domain of the GAL4 gene. Additionally, a library of tomato cDNA was obtained and propagated in a S. cerevisae vector derived from lambda ZAPII. The cDNA library screening and all functional assays developed to identify the interaction among geminiviral proteins were carried out in the yeast two-hybrid system. Differently from the MP and NSP proteins, the REn viral protein was able to activate the transcription when merged to the DNA binding domain. Therefore, it was impossible to use the REn viral protein as an bait in protein-protein interaction assays by this system. The correct expression of the movement proteins MP and NSP, directed by the two-hybrid vectors, was demonstraded by the interaction capacity of recombinant proteins, activating its reporting genes. The interaction between MP and NSP, identified in the present work, is consistent with the models that describe the geminivirus movement within the host, which suggest the interaction between these two proteins during the viral genome translocation. The NSP protein was utilized as bait in the protein-protein interaction assays, using as target proteins codified by the tomato cDNA library. The screeninf of the library resulted in the identification of five cDNAs that code for proteins capable of interacting with NSP with different intensities, according to the quantitative assays of the reporter gene β-galactosidase. Analyses of the sequence and the restriction patterns of these clones demonstrated that four of them were identical and code for a conserved serine/threonine kinase domain, named NIK (NSP - Interacting Kinase). Evidence indicates that the interaction between NIK and NSP is probably functional. The analysis of the NSP primary structure showed the presence of serine and threonine residues suitable to phosphorylation. Besides, NIK was not able to interact with other viral proteins and with controls using the two-hybrid system, corroborating the specificity of the NSP-NIK interaction. The comparative analysis of the NIK s cDNA partial sequence with cDNAs provided from a soybean library showed that the NIK protein has a sequence similarity of about 92% with a kinase protein from soybean, in the carboxy-terminal region. The kinase identified in soybean, named GmNIK (Glicine max NIK), has 623 amino acid residues, a molecular mass around 68586.10 kDa and showed the ability of interact with NSP using the two-hybrid system. The GmNIK has a kinase domain 309 419 IIHRDVKAANILL 431 , an ATP binding domain LGKGFGNVYKKGVFPDGTLVAVKK 332 , a transmembrane helix, which is probably responsible for the introduction of the protein in the plasmatic 96 membrane, and leucine-rich regions, such as LTNQIVLLQNNNISGPIPSELGKLKLTQLDLSNNFFSGGIPPSLGHL 144 and 167 MTQLNFLDLSYNNLSGPVPRILAKS 192 . Domains found in GmNIK are characteristic of proteins encoded by resistance genes and of membrane receptors involved in developmental programing. The prediction of a topological model of GmNIK based on its modular structure, similar to the protein encoded by the resistance gene Xa21, suggests an intracellular position of the kinase and nucleotide biding domain, while the leucine-rich regions are located in the extracellular environment. The intracellular position of the kinase domain is consistent to the hypothesis of functional interaction between GmNIK and NSP, since NSP is located inside the cell. Additional assays will be carried out in order to confirm whether the NSP viral protein is phosphorylated by NIK in vitro and in vivo. / Tese importada do Alexandria

Made available in DSpace on 2014-06-11T19:34:59Z (GMT). No. of bitstreams: 0 Previous issue date: 2009-12-15Bitstream added on 2014-06-13T19:24:03Z : No. of bitstreams: 1 marubayashi_jm_dr_botfca.pdf: 931972 bytes, checksum: 9c460e6d355ca8d5a17b125ad750bfb2 (MD5) / Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq) / Tomato severe rugose virus – ToSRV é um vírus pertencente ao gênero Begomovirus da família Geminiviridae, proveniemte de pimentão e transmitido pelo aleirodídeo Bemisia tabaci biótipo B. Este biótipo B foi introduzido no início dos anos 90, é um inseto polífago reproduzindo-se em mais de 500 espécies de plantas anuais e herbáceas. Causa danos diretos como a sucção de seiva com ação toxicogênica e aparecimento de fumagina, e danos indiretos pela transmissão de vírus, principalmente os begomovírus. O presente trabalho teve como objetivo estudar a interação do isolado ToSRV [PJU] com o vetor Bemisia tabaci biótipo B, avaliar a atratividade do inseto à diversos acessos de Capsicum spp., e determinar os biótipos de mosca-branca encontrados no Estado de São Paulo. Para avaliar a eficiência de transmissão do vírus pelo inseto foram realizadas as combinações tomateiro para tomateiro (T/T), tomateiro para pimentão (T/P), pimentão para pimentão (P/P) e pimentão para tomateiro (P/T). As melhores condições de transmissão foram observadas com temperaturas ao redor de 30 ºC, a partir de T/T e P/T. Quando diferentes números de insetos foram utilizados houve um aumento na transmissão, exceto para a combinação de P/P, onde não foi verificada esta correlação. Com relação ao período de acesso à aquisição, foi observado que maiores tempos de aquisição promoveram aumento na transmissão do vírus pela mosca-branca para T/T e P/T, enquanto que na combinação T/P e P/P, menores tempos de aquisição permitiram uma melhor transmissão.Utilizando-se um período de acesso à inoculação mínima de 15 minutos, foi possível a transmissão do vírus pelo inseto, exceto na combinação P/T e quanto maior este período, maior a taxa de transmissão. Não foi possível avaliar o período de latência, utilizando-se apenas um inseto e transferindo-o durante... / Tomato severe rugose virus - ToSRV is a virus belonging to the genus Begomovirus, family Geminiviridae, isolated from sweetpepper and transmitted by the aleyrodideo Bemisia tabaci biotype B. This new biotype B was introduced in the beginning of years 90 and it is an insect that multiplies in more than 500 species of annual and herbaceous plants. It toxicogenic action causes damages by suction the plants, the development of a fungus, fumagina, and these insects are vectors of different species of viruses, mainly begomovirus. The objective of this work, was to evaluate the interaction of the isolate ToSRV[PJU] with the vector Bemisia tabaci biotype B, to evaluate the attractiveness of the insect for the diverse genotypes of Capsicum spp, and to determine the biotype of whitefly in the State of São Paulo. To evaluate the efficiency of transmission of the virus by the insect different combinations were analyzed: tomato for tomato (T/T), tomato for sweetpepper (T/SP), sweetpepper for sweetpepper (SP/SP) and sweetpepper for tomato (SP/T). The best conditions of transmission were observed with temperatures around of 30 °C, from T/T and SP/T. Generally higher numbers of insects increased the transmission of the virus, but in the combination of SP/SP this was not observed. The acquisition access period was analysed and demonstrated that bigger times increased the transmission of the virus by the whitefly in the combinations T/T and SP/T. This was not observed in combination T/SP and SP/SP. The minimum period access of inoculation was of 15 minutes, except in combination SP/T. With one insect it wasn´t possible to evaluate the period of latency of the virus. It was verified that the leaves of the apex and intermediary of 38 different Capsicum spp. genotypes are the most attractive places for the whitefly and have the h highest egg concentration. The most attractive access was Capsicum frutescens... (Complete abstract click electronic access below)

abstract: Plants are a promising upcoming platform for production of vaccine components and other desirable pharmaceutical proteins that can only, at present, be made in living systems. The unique soil microbe Agrobacterium tumefaciens can transfer DNA to plants very efficiently, essentially turning plants into factories capable of producing virtually any gene. While genetically modified bacteria have historically been used for producing useful biopharmaceuticals like human insulin, plants can assemble much more complicated proteins, like human antibodies, that bacterial systems cannot. As plants do not harbor human pathogens, they are also safer alternatives than animal cell cultures. Additionally, plants can be grown very cheaply, in massive quantities. In my research, I have studied the genetic mechanisms that underlie gene expression, in order to improve plant-based biopharmaceutical production. To do this, inspiration was drawn from naturally-occurring gene regulatory mechanisms, especially those from plant viruses, which have evolved mechanisms to co-opt the plant cellular machinery to produce high levels of viral proteins. By testing, modifying, and combining genetic elements from diverse sources, an optimized expression system has been developed that allows very rapid production of vaccine components, monoclonal antibodies, and other biopharmaceuticals. To improve target gene expression while maintaining the health and function of the plants, I identified, studied, and modified 5’ untranslated regions, combined gene terminators, and a nuclear matrix attachment region. The replication mechanisms of a plant geminivirus were also studied, which lead to additional strategies to produce more toxic biopharmaceutical proteins. Finally, the mechanisms employed by a geminivirus to spread between cells were investigated. It was demonstrated that these movement mechanisms can be functionally transplanted into a separate genus of geminivirus, allowing modified virus-based gene expression vectors to be spread between neighboring plant cells. Additionally, my work helps shed light on the basic genetic mechanisms employed by all living organisms to control gene expression. / Dissertation/Thesis / Doctoral Dissertation Microbiology 2017

Made available in DSpace on 2015-03-26T13:36:33Z (GMT). No. of bitstreams: 1 texto completo.pdf: 1875030 bytes, checksum: 2c2c1497d43bb10ad7e10f009f941c57 (MD5) Previous issue date: 2006-02-23 / Coordenação de Aperfeiçoamento de Pessoal de Nível Superior / Geminiviruses constitute a large group of plant virus whose genome is packed as single-stranded DNA circles in a small, twinned isometric particle and is converted to double- stranded forms in nuclei of differentiated plant cells. Members of the genus Begomovirus, such as Cabbage leaf curl virus (CaLCuV), possess two genomic components, DNA-A and DNA-B. The DNA-A has the potential to code for five gene products (AV1, AC1, AC2, AC3, AC4) and is involved in replication, transcriptional activation of viral genes and encapsidation of the viral genome. The DNA-B encodes two movement proteins, the movement protein MP (BC1) and the nuclear shuttle protein NSP (BV1), both required for systemic infection. NSP shuttles the viral DNA between the nucleus and the cytoplasm and then acts cooperatively with MP to move the viral DNA cell-to-cell across the wall. The localization of NSP and its proposed role in cell-to-cell movement of the viral DNA predict that interactions with host factors may occur in both the cytoplasm and the nucleus. In fact, NSP has been demonstrated to interact with a plasma membrane receptor protein, designated NIK, and a nuclear acetyltransferase. A proline-rich extensin-like receptor protein kinase (PERK) was found to interact specifically with NSP of CaLCuV and of tomato-infecting geminiviruses, through yeast two-hybrid screening. The PERK-like protein, which we designated NsAK (NSP-associated kinase), is structurally organized into a proline-rich N-terminal domain followed by a transmembrane segment and a C-terminal serine/threonine kinase domain. The viral protein interacted stably with defective versions of the NsAK kinase domain but not with the potentially active enzyme in an in vitro binding assay. In vitro translated NsAK enhanced the phosphorylation level of NSP, indicating that NSP functions as substrate for NsAK. These results demonstrated that NsAK is an authentic serine/threonine kinase and suggested a functional link for the NSP-NsAK complex formation. This interpretation was corroborated by in vivo infectivity assays showing that loss of NsAK function delays the onset of CaLCuV infection and attenuates symptom development. Our data implicate NsAK as a positive contributor to geminivirus infection and suggest it may regulate NSP function. / Geminivírus constitui um grande grupo de vírus de planta, cujo genoma é empacotado na forma de DNA circular fita simples em partículas icosaédricas geminadas e é convertido em uma forma fita dupla no núcleo de células diferenciadas de plantas. A maioria dos membros do gênero Begomovirus, como o Cabbage leaf curl vírus (CaLCuV), possuem dois componentes genômicos, DNA-A e DNA-B. O DNA-A apresenta o potencial para codificar cinco produtos gênicos (AV1, AC1, AC2, AC3, AC4) e está envolvido na replicação, ativação transcricional de genes virais e encapsidação do genoma viral. O DNA-B codifica duas proteínas de movimento, Movement Protein MP (BC1) e Nuclear Shuttle Protein NSP (BV1), ambas requeridas para o estabelecimento de uma infecção sistêmica. NSP transporta o DNA viral entre o núcleo e o citoplasma e então atua cooperativamente com MP para transportar o DNA viral de célula-a-célula através da parede celular. A localização de NSP e seu papel proposto no movimento célula- a-célula do DNA viral predizem que podem ocorrer interações com fatores do hospedeiro tanto no citoplasma quanto no núcleo. De fato, foi demonstrado que NSP interage com uma proteína receptora da membrana plasmática, designada NIK, e uma acetiltransferase nuclear. Através de ensaio de duplo híbrido, foi identificada, uma PERK quinase ( proline-rich extensin-like receptor protein kinase ) de Arabidopsis thaliana que interage especificamente com NSP de CaLCuV e, também de geminivírus que infectam tomate, a qual foi designada NsAK ( NSP-associated kinase ) e é estruturalmente organizada em um domínio N-terminal rico em prolina seguido de um segmento transmembrana e de um domínio C-terminal de serina/treonina quinase. A proteína viral interagiu estavelmente com versões defectivas do domínio de quinase de NsAK, mas não com a enzima potencialmente ativa em um ensaio de ligação in vitro. NsAK traduzida in vitro aumentou o nível de fosforilação de NSP, indicando que NSP atua como substrato de NsAK. Estes resultados demonstram que NsAK é uma autêntica serina/treonina quinase e sugerem elo funcional para a formação do complexo NSP-NsAK. Esta interpretação foi corroborada por ensaios de infectividade in vivo, demonstrando que a perda de função de NsAK reduz a eficiência da infecção por CaLCuV e atenua o desenvolvimento dos sintomas. Estes dados implicam NsAK como um contribuidor positivo para a infecção por geminivírus e sugerem que NsAK pode regular a função de NSP.

Made available in DSpace on 2015-03-26T13:42:34Z (GMT). No. of bitstreams: 1 texto completo.pdf: 478603 bytes, checksum: 2f73d62b9c5b69dd70468c095488ebaf (MD5) Previous issue date: 2014-07-25 / Conselho Nacional de Desenvolvimento Científico e Tecnológico / NIK (NSP-Interacting Kinase) is a receptor-like kinase involved in defense against geminiviruses, which was first identified as a virulence target of the begomovirus transport protein NSP (Nuclear Shuttle Protein). We have previously identified that NIK activation mediates an indirect phosphorylation of the ribosomal protein L10 causing the translocation of the cytosolic protein to the nucleus, where it interacts with LIMYB (L10-interacting Myb domain-containing protein) to regulate genes involved in the translation machinery resulting in a global translation suppression. Constitutive activation of NIK, through ectopic expression of the mutant T474D in Arabidopsis, has been previously shown to induce the plant immune system. In this investigation, we examined further whether activation of the signaling module NIK-RPL10-LIMYB would transduce a typical defense signal that promotes the induction of the plant immune system. However, the current results suggest that the NIK-mediated antiviral signaling does not induces the basal immune system. Firstly, the global variation of gene expression by ectopic expression of the constitutively activated mutant receptor T474D or LIMYB does not cause a gene enrichment in the up-regulated list of typical defense categories, such as response to pathogens, response to virus and virus-induced gene silencing. Secondly and very importantly, quantitative RT-PCR of a representative sample of defense genes confirmed that they are not up-regulated by expression of T474D or LIMYB. In contrary, expression of LIMYB in the transgenic lines caused a down-regulation of the defense genes examined. We have also examined new host targets that interact with NSP. Initially, we used a 12000 Arabidopsis protein expression-based microarray to isolate a t-SNARE-like protein with the capacity to bind NSP in vitro. This interaction NSP-At4g30240 protein was further confirmed by two- hybrid assay in yeast and by bimolecular fluorescence complementation assay in planta. Our results indicate that At4g30240 interacts with NSP in vivo to mediate or facilitate the viral protein transport among cell compartments. / NIK (NSP-Interacting Kinase) é um receptor cinase envolvido na resposta de defesa contra geminivírus, e foi primeiramente identificado como alvo de virulência da proteína de transporte NSP (Nuclear Shuttle Protein) de begomovírus. Previamente, foi identificado que a ativação de NIK medeia a fosforilação indireta da proteína ribossomal L10, promovendo a translocação da proteína citosólica para o núcleo, onde interage com a proteína LIMYB (L10-interacting Myb domain-containing protein), para regular genes envolvidos na maquinaria de tradução da célula, resultando em supressão da tradução global. Foi também demonstrado que a ativação constitutiva de NIK1, através da expressão ectópica do mutante T474D, induz o sistema imune de plantas em Arabidopsis. Nesta investigação, foi analisado em maiores detalhes se a ativação do módulo de sinalização NIK-RPL10-LIMYB também transmitiria um sinal típico de defesa, resultando na indução do sistema imune de plantas. Entretanto, os resultados encontrados sugerem que a via de sinalização antiviral mediada por NIK não transmite o sinal de defesa típico que culmina na ativação de genes relacionados ao sistema imune de plantas. Em primeiro lugar, por meio de estudos de variação global de expressão gênica, induzida por expressão ecotópica do mutante constitutivo T474D ou LIMYB, foi constatado que não houve enriquecimento gênico significativo na lista dos genes regulados positivamente nas categorias de defesa, como resposta de defesa a patógenos, resposta de defesa a vírus e silenciamento gênico induzido por vírus. Além disso, RT- PCR quantitativo de uma amostra representativa dos genes de defesa confirmou que estes genes de defesa não foram regulados positivamente pela expressão de T474D ou LIMYB. Ao contrário, a expressão de LIMYB nas linhagens transgênicas promoveu a regulação negativa dos referidos genes de defesa. Nesta investigação, também se avaliou novos alvos do hospederio que interagem com NSP. Inicialmente, foi isolada, por meio de microarranjos de expressão de 12.000 proteínas de Arabidopsis, uma proteína com características de uma t-SNARE, codificada pelo locus At4g30240 com a capacidade de interagir com NSP in vitro. Esta interação NSP- proteína At4g30240 foi confirmada em ensaios de duplo hibrido em leveduras e por ensaios de complementação de fluorescência bimolecular in planta. Os resultados indicam que At4g30240 interage com NSP in vivo, e pode mediar ou mesmo facilitar o transporte dessa proteína viral entre compartimentos celulares.

Resumo: Tomato severe rugose virus - ToSRV é um vírus pertencente ao gênero Begomovirus da família Geminiviridae, proveniemte de pimentão e transmitido pelo aleirodídeo Bemisia tabaci biótipo B. Este biótipo B foi introduzido no início dos anos 90, é um inseto polífago reproduzindo-se em mais de 500 espécies de plantas anuais e herbáceas. Causa danos diretos como a sucção de seiva com ação toxicogênica e aparecimento de fumagina, e danos indiretos pela transmissão de vírus, principalmente os begomovírus. O presente trabalho teve como objetivo estudar a interação do isolado ToSRV [PJU] com o vetor Bemisia tabaci biótipo B, avaliar a atratividade do inseto à diversos acessos de Capsicum spp., e determinar os biótipos de mosca-branca encontrados no Estado de São Paulo. Para avaliar a eficiência de transmissão do vírus pelo inseto foram realizadas as combinações tomateiro para tomateiro (T/T), tomateiro para pimentão (T/P), pimentão para pimentão (P/P) e pimentão para tomateiro (P/T). As melhores condições de transmissão foram observadas com temperaturas ao redor de 30 ºC, a partir de T/T e P/T. Quando diferentes números de insetos foram utilizados houve um aumento na transmissão, exceto para a combinação de P/P, onde não foi verificada esta correlação. Com relação ao período de acesso à aquisição, foi observado que maiores tempos de aquisição promoveram aumento na transmissão do vírus pela mosca-branca para T/T e P/T, enquanto que na combinação T/P e P/P, menores tempos de aquisição permitiram uma melhor transmissão.Utilizando-se um período de acesso à inoculação mínima de 15 minutos, foi possível a transmissão do vírus pelo inseto, exceto na combinação P/T e quanto maior este período, maior a taxa de transmissão. Não foi possível avaliar o período de latência, utilizando-se apenas um inseto e transferindo-o durante... (Resumo completo, clicar acesso eletrônico abaixo) / Abstract: Tomato severe rugose virus - ToSRV is a virus belonging to the genus Begomovirus, family Geminiviridae, isolated from sweetpepper and transmitted by the aleyrodideo Bemisia tabaci biotype B. This new biotype B was introduced in the beginning of years 90 and it is an insect that multiplies in more than 500 species of annual and herbaceous plants. It toxicogenic action causes damages by suction the plants, the development of a fungus, fumagina, and these insects are vectors of different species of viruses, mainly begomovirus. The objective of this work, was to evaluate the interaction of the isolate ToSRV[PJU] with the vector Bemisia tabaci biotype B, to evaluate the attractiveness of the insect for the diverse genotypes of Capsicum spp, and to determine the biotype of whitefly in the State of São Paulo. To evaluate the efficiency of transmission of the virus by the insect different combinations were analyzed: tomato for tomato (T/T), tomato for sweetpepper (T/SP), sweetpepper for sweetpepper (SP/SP) and sweetpepper for tomato (SP/T). The best conditions of transmission were observed with temperatures around of 30 °C, from T/T and SP/T. Generally higher numbers of insects increased the transmission of the virus, but in the combination of SP/SP this was not observed. The acquisition access period was analysed and demonstrated that bigger times increased the transmission of the virus by the whitefly in the combinations T/T and SP/T. This was not observed in combination T/SP and SP/SP. The minimum period access of inoculation was of 15 minutes, except in combination SP/T. With one insect it wasn't possible to evaluate the period of latency of the virus. It was verified that the leaves of the apex and intermediary of 38 different Capsicum spp. genotypes are the most attractive places for the whitefly and have the h highest egg concentration. The most attractive access was Capsicum frutescens... (Complete abstract click electronic access below) / Orientador: Marcelo Agenor Pavan / Coorientador: Renate Krause Sakate / Banca: Antonio Carlos Maringoni / Banca: Edson Luiz Lopes Baldin / Banca: Valdir Atsushi Yuki / Banca: Romulo Fujito Kobori / Doutor

Submitted by Cássia Santos (cassia.bcufg@gmail.com) on 2017-03-24T12:53:45Z No. of bitstreams: 2 Dissertação - Geisiane Alves Rocha - 2017.pdf: 2262501 bytes, checksum: 07907cdfd4fccd850c41b5d258f6f6a5 (MD5) license_rdf: 0 bytes, checksum: d41d8cd98f00b204e9800998ecf8427e (MD5) / Approved for entry into archive by Luciana Ferreira (lucgeral@gmail.com) on 2017-03-24T13:02:10Z (GMT) No. of bitstreams: 2 Dissertação - Geisiane Alves Rocha - 2017.pdf: 2262501 bytes, checksum: 07907cdfd4fccd850c41b5d258f6f6a5 (MD5) license_rdf: 0 bytes, checksum: d41d8cd98f00b204e9800998ecf8427e (MD5) / Made available in DSpace on 2017-03-24T13:02:10Z (GMT). No. of bitstreams: 2 Dissertação - Geisiane Alves Rocha - 2017.pdf: 2262501 bytes, checksum: 07907cdfd4fccd850c41b5d258f6f6a5 (MD5) license_rdf: 0 bytes, checksum: d41d8cd98f00b204e9800998ecf8427e (MD5) Previous issue date: 2017-02-20 / Coordenação de Aperfeiçoamento de Pessoal de Nível Superior - CAPES / To understand how new viruses arise in agriculture, the interface zones between native systems and cultivated areas become an interesting object of study. The small number of studies focused on the detection of viruses, mainly with RNA genomes, in cerrado tree species in the interface zones is due to the difficulty of extracting quality nucleic acids for the necessary analysis. In the case of DNA viruses, such as begomovirus, to date there have been no reports on tree species in this type of vegetation. Begomovirus are among the main pathogens in different cultures in Brazil. However, in soybeans, one of the main crops in the country, these viruses are not among the most important pathogens for the culture, however, it is of great importance to identify different hosts of these viruses and in which environments they occur to know their diversity. The objective of this study was to detect and identify begomovirus in cerrado native trees and cultivated soybean plants near native vegetation areas, as well as to establish an efficient RNA extraction protocol for cerrado species in order to facilitate future related research with these plants. For begomovirus detection, samples of 30 tree species were collected from two areas of cerrado, in soybean the sampling was carried out in three areas of the Escola de Agronomia da Universidade Federal de Goiás - Regional Goiânia - planted with different cultivars. For all samples, DNA extraction was performed using a modified CTAB method and the detection was done by means of PCR using primers PAL1v1978 and PAR1c496. For the extraction of RNA, four methods were tested for Xylopia aromatica and Piper arboreum: TRIzol® reagent (method 1), TRIzol® reagent with modifications (method 2) and two methods using CTAB buffer (methods 3 and 4) that present differences in buffers composition in each method. The one that presented the best results was tested to obtain purified RNA of five cerrado tree species. Method 4 was chosen because of its best absorbance ratio (A260 / A280) when compared to the other methods. The RT-PCR of the RNA extracted from five species of cerrado areas showed good results after RNA extraction performed by method 4, qualifying this method as appropriate to obtain quality RNA for the molecular analysis of cerrado species. In the detection of begomovirus in 30 tree species of the cerrado, only Cardiopetalum calophyllum was positive. This is the first report of begomovirus in Brazilian cerrado tree species. The presence of two begomovirus species, Sida micrantha mosaic virus (SimMV) and Tomato severe rugose virus (ToSRV), were detected in one of the areas in the soybean sampled in the areas of the Escola de Agronomia. The ToSRV species was not previously reported in soybean and presents great potential to become an important pathogen for this crop and also for uncultivated plants, since this virus causes great losses in other crops, mainly tomato, and it has been demonstrated that its host range has increased in recent years. / Para se entender como novos vírus surgem na agricultura, as zonas de interface entre os sistemas nativos e as áreas cultivadas tornam-se um interessante objeto de estudo. O pequeno número de estudos focados na detecção de vírus, principalmente de RNA, em espécies arbóreas do cerrado nas zonas de interface é devido à dificuldade de extração de ácidos nucleicos de qualidade para análises necessárias. No caso dos vírus de DNA, como os begomovírus, até o momento não haviam relatos em espécies arbóreas nesse tipo de vegetação. Os begomovírus estão entre os principais patógenos em diferentes culturas no Brasil, entretanto em soja, uma das principais culturas do país, esses vírus não estão entre os patógenos mais importantes para cultura, porém, é de grande importância identificar diferentes hospedeiras desses vírus e em que ambientes ocorrem para conhecer sua diversidade. Assim, o objetivo geral do trabalho foi detectar e identificar begomovírus em espécies arbóreas nativas do cerrado e em plantas de soja cultivadas próximas a áreas de vegetação nativa e também estabelecer protocolo de extração de RNA eficiente para espécies do cerrado com intuito de facilitar pesquisas futuras relacionadas com essas plantas. Para detecção de begomovírus, amostras de 30 espécies arbóreas foram coletadas de duas áreas de cerrado, em soja a amostragem foi realizada em três áreas da Escola de Agronomia da Universidade Federal de Goiás – Regional Goiânia – plantadas com diferentes cultivares. Para todas as amostras foi realizada a extração de DNA através de um método CTAB (Brometo de cetil trimetil amônio) modificado e a detecção foi feita por meio de PCR (Reação em cadeia da polimerase) utilizando os primers PAL1v1978 e PAR1c496. Para extração de RNA foram testados quatro métodos a partir de folhas de Xylopia aromatica e Piper arboreum: reagente TRIzol® (método 1), reagente TRIzol® com modificações (método 2) e dois métodos utilizando tampão CTAB (métodos 3 e 4) que possuem diferenças nos tampões utilizados em cada método. O que apresentou os melhores resultados foi testado para a obtenção de RNA purificado de cinco espécies arbóreas de cerrado. O método 4 foi escolhido devido aos seus melhores resultados na razão de absorbância (A260 / A280) quando comparado aos outros métodos. A RT-PCR do RNA extraído de cinco espécies de áreas de cerrado mostrou bons resultados após a extração de RNA realizada pelo método 4, qualificando este método como apropriado para obtenção de RNA de qualidade para análise molecular de espécies do cerrado. Na detecção de begomovírus em 30 espécies arbóreas do cerrado, apenas Cardiopetalum calophyllum foi positiva. Este é o primeiro relato de begomovírus em espécie arbórea do cerrado brasileiro. Na soja, as plantas sintomáticas amostradas nas áreas da Escola de Agronomia foram positivas, sendo que em uma das áreas foi detectada a presença de duas espécies de begomovírus: Sida micrantha mosaic virus (SimMV) e Tomato severe rugose virus (ToSRV). A espécie ToSRV não foi relatada anteriormente em soja e apresenta grande potencial para se tornar um importante patógeno para essa cultura e também para plantas não cultivadas, já que esse vírus causa grandes perdas em outras culturas, principalmente tomateiro, e tem sido demonstrado que sua gama de hospedeiras tem aumentado nos últimos anos.

O tomateiro (Lycopersicon esculentum) é cultivado em várias regiões durante todo o ano, propiciando assim condições favoráveis ao surgimento de inúmeras doenças incluindo as causadas por vírus. Dentre as viroses consideradas como limitantes a esta cultura destacam-se as causadas por begomovírus, que pertencem à família Geminiviridae. Sua transmissão se dá pelo aleirodídeo Bemisia tabaci biótipo B. A partir da década de 90 tornaram-se freqüentes os relatos da disseminação desse aleirodídeo e de begomovírus causando perdas que variam de 40% a 100%. No Estado de São Paulo, o Tomato yellow vein streak virus (ToYVSV), até 2005, estava predominando nos campos de tomateiro, onde foram constatadas incidências de plantas com sintomas deste begomovírus variando de 58% a 100%. O presente trabalho teve como objetivos estudar a interação do ToYVSV com o vetor Bemisia tabaci biótipo B e identificar hospedeiras alternativas deste vírus. Na relação do vírus com o vetor constatou-se que os períodos de acesso mínimo de aquisição (PAA) e de inoculação (PAI) foram de 30 min e 10 min, respectivamente. A porcentagem de plantas infectadas chegou até cerca de 75% após um PAA e PAI de 24 h. O período de latência do vírus no vetor foi de 16 horas. O ToYVSV foi retido pela B. tabaci 20 dias após a aquisição deste. Não foi detectada a transmissão do vírus para progênie da B. tabaci biótipo B oriundas de insetos virulíferos. Das 34 espécies de plantas testadas como hospedeiras somente C. annuum, C. amaranticolor, C. quinoa, D. stramonium, G. globosa, N. tabacum cv. TNN e N. clevelandii foram suscetíveis à infecção com o ToYVSV, por meio de inoculação com a B. tabaci. As transmissões do ToYVSV por Cuscuta campestris e mecanicamente foram ineficientes. As espécies susceptíveis ao ToYVSV serviram de fonte de inóculo para a transmissão do vírus para tomateiros por meio de B. tabaci biótipo B. / Tomato (Lycopersicon esculentum) has been cultivated in various parts of Brazil almost during the entire year, which provides favorable conditions for the incidence of innumerous diseases, including those caused by viruses. Among the virus diseases responsible for yield losses on tomato crops are those caused by species in the genus Begomovirus, family Geminiviridae. These viruses are transmitted by the whitefly Bemisia tabaci biotype B. Yield losses associated with begomovirus infection varying from 40% to 100% have been frequently reported since early 90's. Tomato yellow vein streak virus (ToYVSV), a putative species of begomovirus, was prevalent on tomato crops in São Paulo State until 2005, causing yield losses varying from 58% to 100%. The objectives of this work were to study the interaction between ToYVSV am its vector B. tabaci biotype B and to identify alternative host for the virus. The results indicated that the minimum acquisition and inoculation access periods of ToYVSV by B. tabaci were 30 min and 10 min, respectively. Seventy five percent of tomato-test plants were infected when the acquisition and inoculation access periods were 24 h. The latent period of the virus in the insect was 16 h. The ToYVSV was retained by B. tabaci for 20 days after acquisition. First generation of adult whiteflies obtained from viruliferous females did not have the virus as shown by PCR analysis and did not transmit the virus to tomato plants. Out of 34 species of test-plants inoculated with ToYVSV by means of B. tabaci biotype B, only C. annuum, C. amaranticolor, C. quinoa, D. stramonium, G. globosa, N. tabacum cv. TNN and N. clevelandii were susceptible to infection. Attempts to transmit ToYVSV to susceptible hosts mechanically and with Cuscuta campestris failed. B. tabaci biotype B was able to acquire the virus from all susceptible species, transmitting it to tomato test-plants.

[EN] Tomato yellow leaf curl disease (TYLCD) causes great damage in tomato (Solanum lycopersicum L.) crops in south-eastern Spain and in many tropical and subtropical areas in the world. The disease is caused by a complex of viruses, all belonging to the genus Begomovirus, family Geminiviridae. Nine species have been reported causing TYLCD and six more have been proposed as tentative species. Four viral species associated with TYLCD are present in Spain. Preventive measures to fight the disease, as well as measures based on controlling the insect vector (Bemisia tabaci Gen.) are not effective, so the development of resistant varieties seems the best long term strategy. Given that resistance has not been reported in the cultivated species, screening for resistance has been focused on wild tomato relatives. Resistance has been found in different wild species and some resistant breeding lines and commercial varieties have been developed. Ty-1, derived from S. chilense LA1969, is the most frequently used gene. Advances in genetic engineering techniques have also been exploited in developing plant material with pathogen derived resistance. However, resistant varieties currently available are not a solution, as with high inoculum pressure conditions and early infections, plants still develop symptoms and yield losses are caused. For that reason, many research groups continue working worldwide to obtain plants with high levels of resistance to TYLCD. Current breeding objectives are the development of broad spectrum resistance to several begomovirus, the accumulation of resistance genes from different sources to increase the levels of resistance and the identification of molecular markers tightly linked to resistance genes, which allows shortening breeding programmes and accumulating different resistance genes in the same plant material. This work has been developed in the research group ‘Breeding for resistance to Tomato yellow leaf curl disease’ of the Institute for Conservation and Improvement of Agrodiversity (COMAV). When this project was initiated, several resistant plant materials had been developed from previous works of the group. Twelve breeding lines derived from S. chilense LA1932 and LA1938 were available. These lines were resistant to Tomato yellow leaf curl Sardinia virus (TYLCSV), the first viral species described in Spain causing TYLCD. It was of interest the evaluation of resistance in these lines to Tomato yellow leaf curl virus (TYLCV), introduced later in Spain and spread worldwide. Six breeding lines showed high levels of partial resistance to TYLCSV and TYLCV. The resistance consisted on attenuation and delay in symptom development, as well as reduction in viral accumulation. Significant yield losses due to viral infection were not observed in these lines. These lines also show good horticultural traits which make them appropriate to be base material for developing commercial hybrids resistant to both, TYLCSV and TYLCV. High levels of resistance have also been identified in S. pimpinellifolium UPV16991. The resistance has already been fixed in the genetic background of S. lycopersicum. It was convenient to determine the genetic control of the resistance and the expression in tomato background, before using it in breeding programmes. For these purposes L102 was selected. L102 belongs to the F6 generation, after the initial cross S. lycopersicum NE-1 x S. pimpinellifolium UPV16991. Resistance to TYLCV in L102 is controlled by one gene, with partial recessiveness and incomplete penetrance. Moreover, the expression of resistance strongly depends on S. lycopersicum background in which it is introgressed. The highest levels of resistance are obtained when crossing L102 with vigorous lines. So, we recommend to use UPV16991-derived resistance in the development of vigorous hybrids in homozygosis or combined with resistance from other sources. To exploit resistance derived from UPV16991, L102 and some other lines with the same origin were crossed with a breeding line homozygous for Ty-1. Resistance was then evaluated in several plant material heterozygous for both, Ty-1 and the resistance gene from UPV16991. These plant materials showed higher levels of resistance than heterozygotes for each of the genes. Resistance in one of the hybrids was even higher than in homozygotes for each of the genes. These results show that combining resistance from UPV16991 with Ty-1 is the most practical approach to exploiting this resistance, since it allows the development of hybrids without the need of fixing the resistance gene in both parents. Finally, availability of molecular markers tightly linked to the resistance genes is essential to accumulate resistance from different sources. Some molecular markers tightly linked to Ty-1 have been reported. However, in all cases, S. peruvianum-derived Mi gene interferes with these markers, causing false positive results. In this work, a molecular marker, JB-1, tightly linked to Ty-1 has been identified. This is a CAPS (Cleaved Amplified Polymorphic DNA) marker. The presence of Mi, as well as introgressions from other wild tomato relatives such as S. lycopersicum (formerly Lycopersicon esculentum var. cerasiforme), S. habrochaites and S. pimpinellifolium do not interfere with the results for this marker. In addition, the analysis of several plant material with introgressions from different wild tomato relatives has allowed the location of CT21, the RFLP (Restriction Fragment Length Polymorphism) marker from which JB-1 was designed. / [ES] La enfermedad del rizado amarillo del tomate (Tomato yellow leaf curl disease, TYLCD) causa graves daños en los cultivos de tomate (Solanum lycopersicum L.) del sudeste español y de la mayor parte de las zonas tropicales y subtropicales de todo el mundo. La enfermedad está causada por un complejo de virus pertenecientes al género Begomovirus, familia Geminiviridae. Se han descrito nueve especies causantes de TYLCD y otras seis han sido propuestas. En España están presentes cuatro de las especies virales asociadas a TYLCD. Las medidas preventivas de lucha contra la enfermedad, así como las basadas en el control del insecto vector transmisor (Bemisia tabaci Gen.) no resultan efectivas por si mismas, de forma que el desarrollo de materiales resistentes supone la mejor estrategia de lucha a largo plazo. Dado que en la especie cultivada no se han descrito entradas resistentes, la búsqueda de fuentes de resistencia se ha centrado en las especies silvestres del género relacionadas con el tomate. Se ha encontrado resistencia en distintas entradas de algunas de estas especies y se han desarrollado líneas de mejora y materiales comerciales con resistencia procedente de algunas de ellas. El gen Ty-1, derivado de la entrada LA1969 de S. chilense, ha sido el más empleado para la obtención de líneas e híbridos comerciales resistentes. Por otra parte, haciendo uso de los avances en las técnicas de ingeniería genética, también se han desarrollado materiales con resistencia derivada del patógeno. Sin embargo, los materiales resistentes disponibles hasta el momento no suponen una solución definitiva al problema, ya que, con presiones fuertes de inóculo o infecciones tempranas, las plantas desarrollan síntomas de la enfermedad, produciéndose pérdidas de producción. Por este motivo, numerosos grupos de investigación continúan trabajando a nivel mundial con la finalidad de obtener materiales con niveles elevados de resistencia a TYLCD. Entre los objetivos actuales de mejora se incluyen el desarrollo de resistencia de amplio espectro a varios begomovirus, la combinación de genes de distinta procedencia para conseguir mayores niveles de resistencia y la identificación de marcadores moleculares ligados a los genes de resistencia que permitan acortar los programas de mejora y acumular en un mismo material genes de resistencia de distintas fuentes. El grupo de “Mejora para la resistencia a la enfermedad del rizado amarillo del tomate”, del Instituto de Conservación y Mejora de la Agrodiversidad Valenciana (COMAV), en el que se ha realizado la presente tesis doctoral, disponía al inicio de la misma de distintos materiales con resistencia a TYLCD, desarrollados en trabajos previos. Entre estos materiales se encontraban 12 líneas de mejora derivadas de la entradas LA1932 y LA1938 de S. chilense, seleccionadas por su resistencia a la especie Tomato yellow leaf curl Sardinia virus (TYLCSV), la primera especie viral causante de TYLCD detectada en España. Resultaba de interés evaluar la respuesta de estos materiales a la especie Tomato yellow leaf curl virus (TYLCV), introducida posteriormente en España y más extendida a nivel mundial. Seis de las líneas evaluadas han mostrado niveles elevados de resistencia parcial a TYLCSV y TYLCV, consistente en la atenuación en la manifestación de síntomas y retraso en el momento de aparición de los mismos, además de en la reducción de la acumulación viral. Además, no se han observado en estas líneas pérdidas significativas en el rendimiento como consecuencia de la infección por TYLCV. Las características agronómicas las hacen apropiadas como parentales para el desarrollo de híbridos con elevada resistencia a TYLCSV y TYLCV. Por otra parte, se habían identificado niveles elevados de resistencia en la entrada UPV16991 de S. pimpinellifolium. Una vez fijada la resistencia en el fondo genético de S. lycopersicum, y como paso previo al empleo en programas de mejora, era conveniente determinar el control genético de la misma, así como conocer su expresión en el fondo genético de la especie cultivada. Para ello se ha empleado la línea L102, que corresponde a la quinta generación de autofecundación a partir del cruce inicial S. lycopersicum NE-1 x S. pimpinellifolium UPV16991. Se ha comprobado que la resistencia parcial a TYLCV de la línea L102 está controlada por un gen con recesividad parcial y penetración incompleta. Además, la expresión de la misma depende considerablemente del fondo genético de S. lycopersicum en el que se introgresa, obteniéndose los mayores niveles de resistencia en cruces con líneas vigorosas. Por todo esto, se recomienda el uso de esta resistencia bien en homocigosis en el desarrollo de híbridos vigorosos, bien en combinación con resistencia procedente de otras fuentes. En este sentido, se decidió evaluar la resistencia en materiales que combinaban el gen Ty-1 y el gen derivado de UPV16991, ambos en heterocigosis. El nivel de resistencia en estos materiales ha sido superior al mostrado por los heterocigotos para cada uno de los genes, e incluso en algún caso se ha superado la resistencia de los homocigotos para cada uno de los genes. Esto indica que la combinación de la resistencia derivada de UPV16991 con el gen Ty-1 es la aproximación más práctica para la utilización de esta resistencia, ya que evita la necesidad de fijar el gen de resistencia en ambos parentales. Por último, para la acumulación de resistencia de distinta procedencia en un mismo material, resulta imprescindible disponer de marcadores moleculares ligados a los genes de resistencia. Se han descrito algunos marcadores ligados al gen Ty-1, sin embargo, la presencia del gen Mi, derivado de S. peruvianum, interfiere con los resultados para estos marcadores, obteniéndose falsos positivos. En este trabajo se ha identificado un marcador molecular, JB-1, tipo CAPS (Cleaved Amplified Polymorphic DNA) ligado al gen de resistencia Ty-1. La presencia del gen Mi, así como introgresiones de otras especies como S. lycopersicum (antes Lycopersicon esculentum var. cerasiforme), S. habrochaites y S. pimpinellifolium, no interfieren con los resultados para este marcador. Además, el análisis de materiales con introgresiones de distintas especies silvestres relacionadas con el tomate para varios marcadores de la región del Ty-1 ha permitido localizar el marcador CT21, el RFLP (Restriction Fragment Length Polymorphism) a partir del cual se desarrolló JB-1. / [CA] La malaltia de l’arrissat groc de la tomaca (Tomato yellow leaf curl disease, TYLCD) causa greus danys als cultius de tomaca (Solanum lycopersicum L.) del sud-est espanyol i de la major part de les zones tropicals i subtropicals de tot el món. La malaltia està causada per un complex de virus pertanyents al gènere Begomovirus, família Geminiviridae. S’han descrit nou espècies causants de TYLCD i altres sis han sigut proposades. A Espanya estan presents quatre de les espècies virals associades a TYLCD. Les mesures preventives de lluita contra la malaltia, així com les basades en el control de l’insecte vector transmissor (Bemisia tabaci Gen.) no resulten efectives per si mateixes, de manera que el desenvolupament de materials resistents suposa la millor estratègia de lluita a llarg termini. Atés que en l’espècie cultivada no s’han descrit entrades resistents, la recerca de fonts de resistència s’ha centrat en les espècies silvestres del gènere relacionades amb la tomaca. S’ha trobat resistència en distintes entrades d’algunes d’estes espècies i s’han desenvolupat línies de millora i materials comercials amb resistència procedent d’algunes d’elles. El gen Ty-1, derivat de l’entrada LA1969 de S. chilense, ha sigut el més utilitzat per a l’obtenció de línies i híbrids comercials resistents. D’altra banda, fent ús dels avanços en les tècniques d’enginyeria genètica, també s’han desenvolupat materials amb resistència derivada del patogen. No obstant, els materials resistents disponibles fins al moment no suposen una solució definitiva al problema, ja que, amb pressions fortes d’inòcul o infeccions primerenques, les plantes desenvolupen símptomes de la malaltia, produint-se pèrdues de producció. Per este motiu, nombrosos grups d’investigació continuen treballant a nivell mundial amb la finalitat d’obtindre materials amb nivells elevats de resistència a TYLCD. Entre els objectius actuals de millora s’inclouen el desenvolupament de resistència d’ampli espectre a diversos begomovirus, la combinació de gens de distinta procedència per a aconseguir majors nivells de resistència i la identificació de marcadors moleculars lligats als gens de resistència que permeten acurtar els programes de millora i acumular en un mateix material gens de resistència de distintes fonts. El grup de “Millora per a la resistència a la malaltia de l’arrissat groc de la tomaca”, de l’Institut de Conservació i Millora de l’Agrodiversitat Valenciana (COMAV), en el que s’ha realitzat la present tesi doctoral, disposava a l’inici de la mateixa, de distints materials amb resistència a TYLCD, desenvolupats en treballs previs. Entre estos materials es trobaven 12 línies de millora derivades de l’entrades LA1932 i LA1938 de S. chilense, seleccionades per la seua resistència a l’espècie Tomato yellow leaf curl Sardinia virus (TYLCSV), la primera espècie viral causant de TYLCD detectada a Espanya. Resultava d’interés avaluar la resposta d’estos materials a l’espècie Tomato yellow leaf curl virus (TYLCV), introduïda posteriorment a Espanya i més estesa a nivell mundial. Sis de les línies avaluades han mostrat nivells elevats de resistència parcial a TYLCSV i TYLCV, consistent en l’atenuació en la manifestació de símptomes, retard en el moment d’aparició dels mateixos i reducció de l’acumulació viral. A més, no s’han observat en estes línies pèrdues significatives en el rendiment com a conseqüència de la infecció per TYLCV. Les característiques agronòmiques les fan apropiades com a parentals pel desenvolupament d’híbrids amb elevada resistència a TYLCSV i TYLCV. D’altra banda, s’havien identificat nivells elevats de resistència en l’entrada UPV16991 de S. pimpinellifolium. Una vegada fixada la resistència en el fons genètic de S. lycopersicum, i com a pas previ a l’ús en programes de millora, era convenient determinar el control genètic de la mateixa, així com conéixer la seua expressió en el fons genètic de l’espècie cultivada. Per a això s’ha emprat la línia L102, que correspon a la quinta generació d’autofecundació a partir del creuament inicial S. lycopersicum NE-1 x S. pimpinellifolium UPV16991. S’ha comprovat que la resistència parcial a TYLCV de la línia L102 està controlada per un gen amb recessivitat parcial i penetració incompleta. A més, l’expressió de la mateixa depén considerablement del fons genètic de S. lycopersicum en el que s’introgresa, obtenint-se els majors nivells de resistència en creuaments amb línies vigoroses. Per tot açò, es recomana l’ús d’esta resistència bé en homozigosis en el desenvolupament d’híbrids vigorosos, bé en combinació amb resistència procedent d’altres fonts. En este sentit, es va decidir avaluar la resistència en materials que combinaven el gen Ty-1 i el gen derivat d’UPV16991, ambdós en heterozigosis. El nivell de resistència en estos materials ha sigut superior al mostrat pels heterozigots per a cada un dels gens, i fins i tot en algun cas s’ha superat la resistència dels homozigots per a cada un dels gens. Açò indica que la combinació de la resistència derivada d’UPV16991 amb el gen Ty-1 és l’aproximació més pràctica per a la utilització d’esta resistència, ja que evita la necessitat de fixar el gen de resistència en ambdós parentals. Finalment, per a l’acumulació de resistència de distinta procedència en un mateix material, resulta imprescindible disposar de marcadors moleculars lligats als gens de resistència. S’han descrit alguns marcadors lligats al gen Ty-1, no obstant, la presència del gen Mi, derivat de S. peruvianum, interferix amb els resultats per a estos marcadors, obtenint-se falsos positius. En este treball s’ha identificat un marcador molecular, JB-1, tipus CAPS (Cleaved Amplified Polymorphic DNA) lligat al gen de resistència Ty-1. La presència del gen Mi, així com introgresions d’altres espècies com S. lycopersicum (abans Lycopersicon esculentum var. cerasiforme), S. habrochaites i S. pimpinellifolium, no interferixen amb els resultats per a este marcador. A més, l’anàlisi de materials amb introgresions de distintes espècies silvestres relacionades amb la tomaca per a diversos marcadors de la regió del Ty-1 ha permés localitzar el marcador CT21, el RFLP (Restriction Fragment Length Polymorphism) a partir del qual es va desenvolupar JB-1. / This research was supported by the “Ministerio de Ciencia y Educación”, project number AGL2001-1857-C04-03. / Pérez De Castro, AM. (2007). Mejora genética para la resistencia a los geminivirus tomato yellow leaf curl virus (TYLCV) y tomato yellow leaf curl sardinia virus (TYLCSV) en tomate [Tesis doctoral]. Universitat Politècnica de València. https://doi.org/10.4995/Thesis/10251/135825 / TESIS