S. thermophilus est une bactérie largement employée dans la fabrication des produits laitiers. La capacité des souches de S. thermophilus à générer des peptides bioactifs à partir des caséines bovines a été étudiée. Dix souches exprimant différemment la protéase de surface, PrtS, ont été incubées en présence de la caséine [alpha]s1, [alpha]s2 ou [bêta]. Le nombre et le type de peptides libérés dépendent de la souche utilisée. Des peptides connus comme des peptides bioactifs ont été détectés : 13 peptides ont été générés à partir de la caséine [bêta], 5 peptides à partir de la caséine [alpha]s2 et 2 peptides à partir de la caséine [alpha]s1. L'utilisation de cette bactérie pour la production de tels peptides dans l'aliment requiert qu'elle en internalise le moins possible. Nous nous sommes intéressés aux systèmes de transport de peptides présents au sein de l'espèce S. thermophilus. Une collection de 22 souches de S. thermophilus a été choisie pour étudier la variabilité des systèmes de transport des peptides présents au sein de l'espèce. Toute d'abord, la proximité phylogénétique entre les souches a été évaluée par MLST, puis la variabilité génétique du système de transport des oligopeptides Ami et du transporteur de di- et tripeptides DtpT a été étudiée au sein de cette collection. Un cluster, composé de 4 gènes, annoté en tant que transporteur ABC de peptides et de nickel a été détecté au sein du génome de la souche LMD-9, et appelé Ots. Il est présent chez 9 sur 22 souches de S. thermophilus et est transcrit tout au long de la croissance en milieu M17. La caractérisation du système Ots suggère qu'il est impliqué dans l'internalisation de peptides de petites tailles / S. thermophilus is a widely used bacterium in the manufacture of dairy products. The capacity of S. thermophilus to generate bioactive peptides from bovine caseins was studied. Ten strains expressing different levels of the cell envelope protease, PrtS, were incubated with [alpha]s1-, [alpha]s2- or [beta]-casein. Number and type of peptides released were strain-dependent. Peptides known as bioactive peptides were detected: 13 peptides were generated from [beta]-casein, 5 peptides from [alpha]s2-casein and 2 peptides from [alpha]s1-casein. The use of this bacterium for the production of such peptides in the food products requires the least internalization of these peptides by this bacterium. We were interested in knowing the peptide transport system present in the species S. thermophilus. A collection of 22 strains of S. thermophilus was chosen to study the genetic variability of peptide transport systems present within the species. First of all, we evaluated the phylogenetic proximity between selected strains by MLST, and then the genetic variability of the transport system of oligopeptides Ami and di- and tripeptides transporter, DtpT were studied in this collection. A cluster consisting of four genes, annotated as ABC transporter of peptides and nickel was detected in the genome of strain LMD-9, and called Ots. It is present in 9 of 22 strains of S. thermophilus and is transcribed throughout the growth in M17 medium. The Ots system seems to be involved in the internalization of smaller sized peptides

Streptococcus thermophilus, bactérie utilisée en industrie agro-alimentaire, est soumise à de nombreuses modifications environnementales (modification de la concentration en oxygène, de la température, du pH, ...) lors de la fabrication de produits fermentés. Pour s'adapter à ces modifications, la bactérie dispose de systèmes de défense qui sont contrôlés par des réseaux de régulation impliquant notamment des régulateurs transcriptionnels. Parmi eux, se trouvent les régulateurs de la famille Rgg. Les gènes Rgg codent des régulateurs transcriptionnels très polymorphes. Plusieurs études ont montré leur implication dans la réponse aux stress. L'originalité de S. thermophilus est que de nombreuses copies Rgg différentes sont présentes sur les génomes de cette espèce bactérienne (entre 5 et 7 copie selon les souches). Cette étude a pour objectif la caractérisation de la famille Rgg et l'étude du rôle des gènes Rgg de S. thermophilus, et, notamment, l'implication de ces gènes dans l'adaptation de S. thermophilus à son environnement. Les analyses réalisées in silico ont permis de montrer que les gènes Rgg sont spécifiques de la famille des Streptocococcaceae et des genres Lactobacillus et Listeria. Les protéines appartenant à cette famille sont polymorphes et ne forment pas un groupe monophylétique. Les analyses ont néanmoins montré que ces protéines se caractérisaient par deux domaines : un « domaine HTH » en position N-terminale, très probablement impliqué dans la liaison à l'ADN et un « domaine médian » en position centrale, dont le rôle reste à déterminer. Les analyses réalisées au cours de ce travail montrent que le gène rgg0182 de S. thermophilus LMG18311 code un régulateur transcriptionnel qui participe, notamment, à la réponse adaptative de S. thermophilus exposée à une augmentation de sa température de croissance. De plus, la délétion du gène Rgg0182 confère aux cellules une capacité d'adhésion à une surface hydrophobe et induit une réduction de la taille des chaînes. L'ensemble de ces phénotypes suggère que la protéine Rgg0182 est un régulateur global de l'expression génique de S. thermophilus LMG18311. Des gènes cibles de ce régulateur ont été recherchés parmi les gènes de réponses au choc thermique et indique que la protéine Rgg0182 est impliquée dans l'homéostasie des chaperons et des protéases. / Streptococcus thermophilus, bacterium used in dairy industry, is subjected to many environmental changes (oxygen concentration modification, temperature shift, pH variation...) during manufacturing of fermented products. To adapt itself to these modifications, bacterium has defense systems which are controlled by regulation networks involving, in particular, transcriptional regulators. Among them, they are transcriptional regulators of the Rgg family. rgg genes code transcriptional regulators which are very polymorph. Several studies showed their involvement in stress response. The originality of S. thermophilus is the presence of many different rgg copies on genomes of this bacterial species (between 5 and 7 copy according to strain). Objective of this study is the characterization of the Rgg family and study of the S. thermophilus rgg gene function, and, in particular, involvement of these genes in S. thermophilus adaptation to environmental changes. In silico analyses has allowed to show that rgg genes are specific to the Streptocococcaceae family of and the Lactobacillus and the Listeria genus. Proteins belonging to this family are polymorphic and don?t form a monophyletic group. Analyses nevertheless showed that these proteins were characterized by two domains: a "HTH domain" in N-terminal position, very probably involved in the DNA interaction, and a "median domain" in central position which the role remains to determine. Analyses realized during this work show that S. thermophilus LMG18311 rgg0182 gene codes a transcriptional regulator which participates, in particular, in the adaptive response of S. thermophilus exposed to an increase of its growth temperature. Furthermore, the deletion of the rgg0182 gene confers on cells the capacity of a hydrophobic surface adhesion and leads to a reduction of cells chains size. All these phenotypes suggest that Rgg0182 protein is a global regulator of S. thermophilus LMG18311 genic expression. Target genes of this regulator were looked for among genes of thermal stress response and indicate that Rgg0182 protein is involved in the chaperons and proteases homeostasis.

Les éléments intégratifs conjugatifs (ICE) sont des éléments génétiques mobiles se transférant horizontalement d’une bactérie à une autre. Les ICE sont porteurs de gènes adaptatifs pouvant significativement améliorer le fitness de la bactérie hôte et permettre son adaptation à de nouvelles niches écologiques. Lors de ces travaux, des ICE apparentés à ICESt3 ont été retrouvés chez la bactérie commensale et pathogène opportuniste Streptococcus salivarius. Les analyses in silico réalisées ont démontré la diversité des ICE de cette famille, notamment au niveau de leurs modules de recombinaison, de régulation mais aussi de leurs gènes adaptatifs potentiellement mis à disposition de la communauté microbienne orale et digestive de l’Homme. La fonctionnalité de deux de ces ICE a été mise en évidence expérimentalement à travers l’évaluation de la capacité de ces éléments à se transférer intra- et inter-spécifiquement. Ces travaux ont également permis l’identification de facteurs d’hôte influençant la mobilité d’ICESt3, révélant ainsi l’importance, pour le transfert et l’acquisition de cet ICE, des molécules de surface telles que les lipoprotéines, les acides téichoïques et les exopolysaccharides. En conclusion, il a été démontré que les éléments de la famille ICESt3 participent à l’évolution du génome chez différentes espèces de streptocoques et aux échanges génétiques entre bactéries issues de l’alimentation et bactéries de la flore digestive humaine. Enfin, ces travaux ont contribué à une meilleure compréhension des mécanismes et des facteurs d’hôte influençant la mobilité de ces éléments génétiques mobiles / Integrative Conjugative Elements (ICEs) are mobile genetic elements that can be horizontally transferred from a bacterium to another, eventually regardless of the species or any other classification, allowing them to benefit from a broad host spectrum. ICEs can carry adaptive genes that can significantly improve the bacterial fitness and allow its adaptation to new ecological niches. In this work, ICEs related to ICESt3 were found in the commensal and opportunistic pathogen Streptococcus salivarius. In silico analysis highlighted the diversity of the ICESt3 family within this species, especially concerning their recombination and regulation modules, but also their adaptive genes likely available for the oral and digestive microbial community of the human host. The functionality of two ICEs found in S. salivarius was experimentally confirmed through their ability to transfer in intra- and interspecific manners. This work also allowed the identification of host factors affecting ICESt3 mobility, and revealed the importance, for the transfer and the acquisition of this ICE, of cell surface molecules such as lipoproteins, teichoic acids and exopolysaccharides. In conclusion, this thesis allowed expanding the knowledge regarding the mobile genetic elements of the ICESt3 family. This work demonstrated that these elements contribute to genome evolution of different streptococci species and gene exchanges between bacteria originated from food and the human gut flora. Finally, this study contributes to a better comprehension of the mechanisms and host factors influencing the mobility of these mobile genetic elements

Cette thèse a pour objectif la caractérisation des gènes rgg de S. thermophilus LMG18311 codant des régulateurs transcriptionnels et l'étude de leur implication dans l'adaptation à l'environnement. Ce travail montre que le gène rgg0182 code un régulateur transcriptionnel activant la transcription de ses gènes adjacents. Par ailleurs, le couple Rgg0182/Shp0182 participerait à un mécanisme de quorum sensing. De plus, la protéine Rgg0182 participe à la tolérance au stress chaud. En outre, les cellules du mutant [delta]rgg0182 présentent un phénotype d'adhésion thermo-induite via des interactions de types hydrophobes. L'analyse par microscopie à force atomique des cellules de la souche LMG18311 et du mutant [delta]rgg0182 révèle la présence de polymères de surface uniquement chez la souche sauvage, suggérant que la protéine Rgg0182 régulerait l'expression de protéines de surface et de la division cellulaire. Une étude protéomique couplée à une analyse transcriptomique ont permis d'identifier plusieurs cibles de Rgg0182 qui participeraient à diverses fonctions biologiques. L'ensemble des données obtenues démontre que la protéine Rgg0182 de S. thermophilus LMG18311 est un régulateur global de l'expression génique. Par ailleurs, la transcription des 7 gènes rgg présents au sein du génome de S. thermophilus LMG18311 est modulée par les conditions environnementales. Les profils de transcription des 7 gènes rgg diffèrent les uns par rapport aux autres, suggérant que chacun d'eux seraient requis dans des conditions de croissances différentes. Ces données posent l'hypothèse que les protéines Rgg participeraient à la régulation fine et complexe de l'expression génique de S. thermophilus / This thesis aims to characterize the rgg genes of S. thermophilus LMG18311 coding transcriptional regulator and their involvement in environmental adaptation. This work shows that rgg0182 gene encodes a transcriptional regulator controlling the transcription of its flanking genes. The Rgg0182/Shp0182 pair could be involved in a quorum sensing mechanism. This work also demonstrates that the Rgg0182 protein is involved in S. thermophilus tolerance to heat stresses. In addition, the mutant delta rgg0182 cells exhibit a thermo-induced adhesion phenotype via hydrophobic interactions. Analyses by atomic force microscopy of LMG18311 cells of the wildtype and its derivative rgg0182 mutant reveal the presence of polymers only on the surface of the wild-type strain, suggesting that the protein Rgg0182 would regulate the expression of surface proteins and proteins of cell division. A proteomic study coupled with transcriptomic analysis led to the identification of several targets of Rgg0182 involving in various biological functions. The data obtained in this work have shown that the S. thermophilus LMG18311 rgg0182 genes encodes a global regulator of gene expression. Furthermore, transcriptional analyses, in different growth conditions, of the 7 rgg genes present in the genome of S. thermophilus LMG18311 showed that they display different expression profiles that are modulated by environmental conditions. This suggests that these genes would be required in distinct growth conditions. These data raise the hypothesis that Rgg proteins participate in the fine and complex regulation of S. thermophilus gene expression

Les produits laitiers (fromages, yaourts, laits fermentés, …) représentent 10% de notre alimentation. Ces produits sont appréciés pour leur flaveur, leur texture et leurs bénéfices sur la santé. Ces caractéristiques sont dues, entre autres, aux peptides contenus dans ces produits, qui sont issus de la coupure des protéines du lait par des enzymes qui sont présentes dans le lait, ajoutées lors de la transformation ou provenant des bactéries. Comprendre et maîtriser l’élaboration des produits laitiers est donc essentiel pour améliorer et développer les aliments futurs. La fabrication des produits laitiers fermentés tels que le fromage commence par la coupure, ou protéolyse, des protéines majeures du lait (les caséines) grâce à différentes enzymes appelées protéases. Certaines sont attachées à la surface des bactéries lactiques qui sont utilisées au début de la fabrication du fromage, telles que Streptococcus thermophilus ou Lactobacillus helveticus. S. thermophilus possède une protéase de paroi, PrtS, déjà bien étudiée contrairement à L. helveticus qui possède quatre protéases de paroi, PrtH, PrtH2, PrtH3 et PrtH4, qui n’ont pas été jusqu’à présent étudiées séparément. L’objectif de ce travail de thèse est de mieux comprendre les propriétés protéolytiques de L. helveticus et S. thermophilus en déterminant comment leurs protéases participent à la protéolyse des caséines en matrice laitière. Deux stratégies ont été mises en place : exprimer une des protéases de L. helveticus dans S. thermophilus afin de l’étudier de façon indépendante et étudier l’activité de chacune des protéases chez des souches qui n’expriment qu’un seul gène de protéase de paroi. D’une part, un outil de sécrétion hétérologue fonctionnel a été mis au point chez S. thermophilus LMD-9. D’autre part, les protéases étudiées présentaient une activité caséinolytique supérieure à pH 5,2 qu’à pH 7,5 et dégradaient préférentiellement la caséine β. Enfin, PrtH3 de L. helveticus semble présenter la plus forte activité caséinolytique / Dairy products (cheeses, yoghurt, fermented milk…) represent 10% of our food. These products are appreciated thanks to their flavor, their texture and their health benefits. These characteristics are due to various compounds like peptides which come from the cutting of milk protein by enzymes. These enzymes come from the milk, are added during the fabrication or come from bacteria. To understand and to master the dairy products fabrication is essential to develop the food of tomorrow. The fabrication of fermented dairy products as cheese begins with the cutting or proteolysis of caseins, the major milk proteins, thanks to enzymes called proteinases. Some of them are attached at the surface of lactic acid bacteria which are used at the beginning of the cheese fabrication, as Streptococcus thermophilus or Lactobacillus helveticus. S. thermophilus possess one cell envelop proteinase, PrtS, already well-studied unlike L. helveticus which possess four cell envelop proteinases, PrtH, PrtH2, PrtH3 and PrtH4, which were not studied separately yet. The aim of this thesis work is to better understand the proteolytic properties of L. helveticus and S. thermophilus and identify how their proteinases adjust the hydrolysis profile of caseins in a dairy matrix.Two strategies were selected: to express one of the proteinases of L. helveticus in S. thermophilus to study it independently from the others and study each proteinase in strains which only express one proteinase gene

Parmi 30 souches, seule 4F44 excrète une activité dans son milieu de culture qui ne résulte pas de la présence de protéases intracellulaires due à une lyse cellulaire.D’après le séquençage N-ter, l’enzyme soluble chez 4F44 est PrtS retrouvée sous deux formes (non mature et mature) à la fois ancrée (60%) et soluble (40%).Sa séquence protéique déduite de prtS est proche de celles de LMD-9 (97% identité), CNRZ385 (98%), JIM8232 (96%) et S. suis (97%) chez qui elle est toujours ancrée. Le domaine d’ancrage contenant LPNTG est conservé chez 4F44, LMD-9, CNRZ385 et S. suis ; ainsi elle serait ancrée au peptidoglycane par la sortase A (SrtA). Chez 4F44, l’absence d’une duplication peptidique imparfaite dans le prodomaine de PrtS pourrait expliquer sa libération partielle, en effet LMD-9 présentant cette duplication possède sa protéase PrtS uniquement sous forme ancrée.La comparaison de la séquence de la sortase déduite du gène de 4F44, ND03, LMD-9, PB18O, PB302 et CNRZ307 a montré que les sites catalytique et actif sont conservés. Seuls 6 résidus d’acides aminés sont différents, la substitution chez 4F44 de I222 par V222 entraînerait sa libération partielle. Les peptides trypsiques C-ter QVTQLPNTGENDTK et QVTQLPNTGENDTKYYLVPGVIIGLGTLLVSIRR ont été identifiés en MS/MS, donc la liaison TG (cible de l’activité peptidasique de SrtA) n’est pas hydrolysée. La caséine β est la caséine préférentiellement hydrolysée. L’enzyme présente une large spécificité de coupure (A, L, M, F, Y, W, V, S, T, N, Q, R, H et K en position P1). Globalement elle libère 33 peptides bioactifs : ECA-inhibiteurs, mitogènes, opioïdes, immunomodulants, antibactériens, antioxydants, antimutagènes / Among 30 strains, only 4F44 strain releases a activity in the medium which does not results from the presence of intracellular protease due to cell lysis. This soluble protease is PrtS in two forms (non mature and mature), 60% as anchored to cell wall and 40% as released in the medium. The protein sequence deduced from the gene is slightly different to those of LMD-9 (97% identity), CNRZ385 (98%), JIM8232 (96%), S. suis (97%). The protein sequence of the anchor domain including LPNTG is conserved as for LMD-9, CNRZ385 and S. suis ; so this PrtS might be anchored to peptidoglycan by sortase A (SrtA).In 4F44, the absence of an imperfect duplication of a peptide sequence at prodomain of PrtS could explain the partial liberation, furthermore, the LMD-9 strain which presents this duplication possess the protease PrtS only the anchored form.Comparison of protein sequence deduced from the srtA gene in 4F44, ND03, LMD-9, PB18O, PB302 and CNRZ307 strains showed that the residues of the catalytic and active sites are conserved. Six amino acids are different for 4F44, I222 replaced by a V222 possibly leads to the partial liberation of PrtS. The trypsic C-ter peptides QVTQLPNTGENDTK and QVTQLPNTGENDTKYYLVPGVIIGLGTLLVSIRR have been identified by MS/MS, indicating that the peptide bond of T and G (target of endopeptidasic activity of Srt A) is not hydrolyzed.β-casein is preferentially degraded in comparison to other caseins. Soluble PrtS has a broad specificity against A, L, M, F, Y, W, V, S, T, N, Q, R, H and K at position P1. Globally, it releases 33 bioactive peptides (antihypertensives, mitogenics, oipoide, immunomodulantors, antimicrobials, antioxydants, antimutagens)

Des analyses de génomes avaient suggéré que de nombreux îlots génomiques bactériens seraient des éléments intégratifs conjugatifs (ICE) ou des éléments en dérivant. Les ICE s'excisent sous forme circulaire par la recombinaison site-spécifique, se transfèrent par conjugaison et s'intègrent chez une cellule réceptrice. Les éléments de ce type sont très abondants aux seins des génomes de bactéries et d'archées. Divers îlots génomiques apparentés sont intégrés dans l'extrémité 3' de l'ORF fda chez plusieurs souches de Streptococcus thermophilus. Cette famille inclut 2 éléments intégratifs potentiellement conjugatifs, dont ICESt3, et 4 éléments qui dérivent d'ICE par délétion, les CIME (cis mobilizable elements). Ce travail a montré qu'ICESt3 se transfère entre souches de S. thermophilus et entre espèces proches. Cet élément est le premier élément conjugatif identifié chez ce streptocoque. Le transfert d'ICESt3 vers une cellule portant un ICE ou un CIME intégré a conduit à l'accrétion site-spécifique d'ICESt3 et d'un îlot génomique apparenté. À partir de cellules portant un tandem CIME-ICE, le co-transfert du CIME et de l'ICE ainsi que le transfert du CIME seul ont été obtenus, démontrant la mobilisation conjugative d'un CIME par ICESt3. Ainsi, les îlots génomiques de S. thermophilus évoluent par accrétion site-spécifique et mobilisation conjugative. Par ailleurs, une analyse de séquences disponibles dans les bases de données et une analyse bibliographique suggèrent très fortement que les CIME sont très répandus et que les événements d'accrétion site-spécifique entre îlots génomiques jouent un rôle important dans l'évolution bactérienne. / Analyses of genomes had suggested that numerous bacterial genomic islands would be integrative conjugative elements (ICEs) or elements deriving from them. ICEs excise under a circular form by site-specific recombination, transfer by conjugation, and integrate in a recipient cell. The type of elements is very widespread in genomes of bacteria and archaea. Various related genomic islands are integrated at the 3' of the fda ORF in different Streptococcus thermophilus strains. This family includes 2 integrative and potentially conjugative elements, of which ICESt3, and 4 elements deriving from ICEs by deletion and named CIMEs (cis mobilizable elements). This work has demonstrated that ICESt3 transfers between S. thermophilus and related species. This element is the first conjugative element identified in this streptococcus. The ICESt3 transfer to a cell already carrying an ICE or a CIME leads to the characterization of site-specific accretions of ICESt3 and a related genomic island. Using donor cell harboring a CIME-ICE tandem, the co-transfer of the CIME and the ICE, the transfer of the ICE and the transfer of the only CIME were obtained, demonstrating conjugative mobilization of a CIME by ICESt3. Thus, the genomic islands from S. thermophilus evolve by site-specific accretion and conjugative mobilization. Moreover, an analysis of sequences from databases and an analysis of literature strongly suggest that CIMEs are widespread and that site-specific accretions between genomic islands play a key role in bacterial evolution.

Made available in DSpace on 2014-06-11T19:31:03Z (GMT). No. of bitstreams: 0 Previous issue date: 2012-03-16Bitstream added on 2014-06-13T20:41:12Z : No. of bitstreams: 1 jardim_fbb_dr_arafcf.pdf: 509534 bytes, checksum: fc200b1470ba9de6e5425553da141715 (MD5) / Universidade Estadual Paulista (UNESP) / O objetivo deste trabalho foi desenvolver uma bebida láctea sabor morango carbonatada e fermentada com bactérias probióticas. Foram elaboradas quatro formulações de bebida láctea: Controle (BL); Fermentada (BLF); Carbonatada (BLC) e Fermentada Carbonatada (BLFC). Nas amostras submetidas à carbonatação, utilizou-se um carbonatador para injeção do gás dióxido de carbono (CO2) dissolvido em água potável, resultando em um produto com a proporção de 2: 1 (volume de gás/ volume de bebida láctea) e nas amostras fermentadas, adotou-se o cultivo constituído das bactérias lácticas Lactobacillus acidophilus-LA-5®, Bifidobacterium BB-12® e Streptococcus thermophilus. As amostras foram caracterizadas quanto a parâmetros físico-químicos (composição química, índice de proteólise e teor de carbonatação), parâmetros microbiológicos (contagens de coliformes totais, E. coli, bolores e leveduras e viabilidade das bactérias lácticas) e aspectos sensoriais através de testes de aceitação e intenção de compra, ao longo de 28 dias de armazenamento refrigerado das bebidas lácteas. As formulações de bebidas fermentadas BLF e BLFC apresentaram diferenças significativas (p < 0,05) em relação às amostras não fermentadas BL e BLC nos parâmetros glicídeos redutores em lactose e em sacarose, pH e índice de proteólise, com menores médias absolutas e acidez com maiores médias em todos os tempos estudados. As bebidas fermentadas BLF e BLFC não apresentaram presença de microrganismos contaminantes. A amostra BLC apresentou presença de leveduras e coliformes totais, mas as contagens indicaram que estava própria para o consumo no tempo 28 dias. Entretanto, a amostra controle (BL) apresentou contagens... / The goal of this work was to develop a strawberry flavored dairy beverages carbonated and fermented with probiotic bacteria. Four formulas of dairy beverages were elaborated: Control (BL); Fermented (BLF); Carbonated (BLC) and Carbonated Fermented (BLFC). In samples submitted for carbonation, a carbonator was used for the carbon dioxide (CO2) gas injection dissolved in drinking water, resulting in a product with a ratio of 2:1 (volume of gas volume of dairy beverages) and the cultivation consisting of lactic bacteria Lactobacillus acidophilus-LA-5®, Bifidobacterium BB-12® and Streptococcus thermophilus was employed on the fermented samples. The samples were characterized by physical and chemical parameters (chemical composition, proteolysis index and carbonation proportion), microbiological parameters (total coliform counts, E. coli, yeasts and molds and viability of the lactic bacteria) and sensory aspects through acceptance testing and purchase intention, over the course of 28 days of refrigerated storage of the dairy beverages. The formulations of the BLF and BLFC fermented drink presented significant differences (p < 0,05) in relation to the non-fermented samples BL and BLC in glucides reducer of lactose and sucrose parameters, pH and proteolysis index, with lower absolute averages and acidity with higher averages at all studied times. The fermented beverages BLF and BLFC did not show any presence of contaminating microorganisms. The BLC sample showed the presence of yeasts and coliform counts, but the counts indicated that it was suitable for consumption in 28 days time. However, the sample... (Complete abstract click electronic access below)

This study investigated the role of exopolysaccharide (EPS) in cheese moisture retention. Analysis of low-fat Mozzarella cheese made with different combinations of EPS-producing (Streptococcus thermophilus MR-1C and Lactobacillus delbrueckii ssp. bulgaricus MR-lR) and non-EPS-producing (S. thermophilus TA061 and L. helveticus LH100) starters showed significantly higher moisture levels in cheese made with S. thermophilus MR-1C. To determine if the S. thermophilus MR-1C EPS was responsible for increased moisture retention, gene replacement was used to inactivate the epsE gene in this bacterium. Low-fat Mozzarella cheese made with L. helveticus LH100 plus the EPS-negative mutant, S. thermophilus DM1O, had significantly lower moisture content than cheese made with LH100 and MR-1C, which confirmed that the MR-1C capsular EPS was responsible for the water-binding properties of this bacterium in cheese. Chemical analysis of the S. thermophilus MR-lC EPS indicated that it had a repeating unit composed of D-galactose, L-rhamnose, and L-fucose in a ratio of 5:2:1. Interestingly, carbohydrate utilization tests showed that DMlO had acquired the ability to ferment galactose.

Differences in texture at any particular stage of ripening depend upon differences in the basic structure and the extent to which the basic structure is modified by physical parameters. Thus, very young cheeses of the same variety differ in texture because of variations in pH and in salt, moisture, and fat content. How well a cheese melts and shreds depend on its texture and physical parameters. Streptococcus thermophilus MR1C produces an exopolysaccharide (EPS) that is tightly associated with the bacterial cell wall. Addition of S. thermophilus MR1C to the cheese make will increase the moisture of the cheese 2-3% and thus affect the texture, melt, and shreddability of that cheese. To determine the effect of S. thermophilus MR1C on the texture, melt, and shreddability of cheese, two stirred-curd cheeses with equivalent physical parameters using BPS-producing S. thermophilus MR1C or non-BPS-producing S. thermophilus DM10 adjunct cultures were produced. Because MR1C cheese would increase moisture, the curd size, wash water temperature, and pH at salting had to be altered in order to make the physical parameters the same for both cheeses. The MR1C cheese was harder and had a higher fracture stress than the DM10 cheese. The MRlC cheese was also more adhesive, but only for one of the two trials. Even with adjustments in the method of manufacture, the MR1C cheese still had a slightly higher SM and pH, which may be partly responsible for the differences between the two cheeses. There were no differences between the MRlC cheese and the DM1 0 cheese in shreddability as determined by fines, stickiness, and gumminess. Cheese produced without a streptoccus adjunct culture was more cohesive and had fewer fines than the MRIC or DM10 cheese.