Traditional dances of the South Sotho of Qwaqwa were studied as a product of culture. The two major objectives were: to document, and analyse specific South Sotho dances and relate them holistically to the culture; and to determine which dances of the girls and the women would be suitable for inclusion in the Syllabus for Physical Education for Girls in the Republic of South Africa according to certain educational criteria. The aspects investigated in the study included the following: 1. An ethnographic image of the South Sotho relating to ancestry, way of life and culture; 2. Dance as a cultural phenomenon and the place and function of dance in the culture of the South Sotho; 3. The notation of selected dances, an analysis of the dance movements and choreographic structure of the dances; 4. The educational value of folk and ethnic dances for implementation in the physical education programme, according to relevant objectives. The techniques used to identify, classify, document and analyse the dances, included fieldwork done through personal observation, participating observation, video filming of the dances, sound recordings of the songs and personal interviews. The sequence of steps was notated descriptively and graphically. The movements of the free body segments and dance technique were described and the floor pattern of each step sequence, the information with the accompaniment and the floor plan of the dance were transcribed graphically. The number of repetitions of the step sequences and the order of the parts of the dances were notated according to counts. The following dances were identified: women's dances - mokgibo, moqoqopelo, ledingwana, thojane, timiti and famu; girls' dances - mokgibo, play dances, ndlamu and bale dances; men's dances - mohobelo, mokorotlo, diphotha and setapo; boys dance the same dances apart from the mokorotlo. Wedding dances and thojane are also danced together by both sexes. The four dances which were documented include the wedding dance Ausi o manele, a play dance (Tikwe ha malome), ledingwana-women's dance (Diponono ha kena basadi) and mogogopelo women's dance (Ke lelekuwe bohadi). The main findings of the study indicated that dance is still closely interlinked with the cultural life of the South Sotho and that the purpose of the dance manifests itself mainly in terms of social recreation. Specific dances of the South Sotho can be utilized in a meaningful way in the physical education programme for girls because of the educational value, the link with the cultural objectives of the folk dance section of the syllabus and the relevance to the present needs of society. / Thesis (MA) -- PU vir CHO, 1985

Participation in campus leisure and recreation programmes can provide university students with various benefits, but the provision of effective leisure programmes are complicated by the changes that have taken place in the demographic composition of the student population attending South African universities. Increases in the proportion of black students attending university, and decreases in the proportion of white students means that current students possibly exhibit leisure behaviours that differ from those of their predecessors. With eleven official languages in South Africa, the language diversity among students is a further issue with which leisure professionals have to contend. Students also come from different economic backgrounds, posing additional challenges to universities’ leisure service providers. Since demographic factors, including culturally based perceptions and values, ethnic identity, language, religious beliefs and family structure (Outley & Witt, 2006:112) may influence leisure behaviour and preferences, it is important for leisure professionals to understand how these factors influence the perceptions students have of leisure. For purposes of this study, leisure perceptions are conceptualised to include leisure meanings, leisure experiences and leisure constraints. Due to the lack of research regarding leisure within a South African context (Goslin, 2003:39; Wegner et al. 2006:249) the purpose of this study was to determine the relationship between demographic variables and leisure perceptions of selected South African first-year university students. The study utilised a once off crosssectional research design, using three research instruments, the Leisure Meanings Inventory (LMI), Leisure Experience Battery for Young Adults (LEBYA) and the leisure constraint questionnaire by Raymore et al. (1993:104). An availability sample was used that comprised 344 first-year students in academic programmes related to sport, leisure and recreation studies from six South African universities. Data analysis included confirmatory factor analyses, t-tests, ANOVA and 2-way ANOVA. For leisure meanings, results indicate that female students are more likely to see leisure as Exercising Choice and Achieving Fulfilment than are male students. Home language also influences leisure meanings, with Afrikaans students seeing leisure as Escaping Pressure, whereas English-speaking students associate it with Passing Time. Students staying in private accommodation associated leisure more with Passing Time than those in university hostels. Furthermore, students that are in a relationship are less likely to see leisure as Achieving Fulfilment than those that are not. For leisure experiences, white students are more aware of leisure benefits and opportunities than are black students, and experience less boredom and distress during their leisure. Additionally, white students are more aware of leisure benefits and opportunities than are Coloured students. Seeing that a lack of awareness of leisure participation benefits and opportunities often are associated with boredom, which in turn is associated with delinquent behaviour, the possibility exists that increased awareness of leisure may assist in combating delinquent behaviour among students. In terms of language, Afrikaans-speaking students and students that speak African languages experienced more challenge in their leisure than their English-speaking counterparts. This result may be either because of ethnic factors, such as traditions or customs associated with specific languages or because of language, per se, as proposed by the Sapir-Whorf hypothesis. With regard to leisure constraints, black students experienced greater interpersonal constraints than did white students, while white students experienced greater structural constraints than did black students. Additionally, Indian students experienced more intrapersonal constraints than did black students. Students staying in university hostels experience less structural constraints than those in private accommodation. Lastly, students from rural areas/informal settlements experienced less intrapersonal and structural constraints than students that grew up in towns and cities. The study is the first of its kind in South Africa, providing a new insight into leisure, and addressing the paucity of research within the South African context. Recommendations include the implementation of comprehensive leisure education programmes to inform students of the benefits of leisure and the opportunities available to them. In so doing, students can be assisted in negotiating constraints and in developing more complex leisure meanings. In order to meet the challenges, leisure professionals need to know how student diversity affects leisure programming; hence training of current leisure practitioners in the form of short learning programmes is suggested. Future research should include: a) modifications to the research instruments to accommodate the South African population and to increase reliability, b) replicating the study on a broader student population to provide a more detailed picture of leisure perception at South African universities, and c) using a mixed-method research design, including both quantitative and qualitative methods for gathering data. / Thesis (PhD (Recreation Science))--North-West University, Potchefstroom Campus, 2013.

Proefskrif--PU vir CHO

This empirical study aimed at determining any significant difference in level of moral judgment between behaviourally handicapped adolescent clinic school pupils of normal intelligence (experimental group) and a matched sample of non-behaviourally handicapped pupils (control group). Moral judgment level was measured in terms of Global stage Scores and Weighted Average Scores using Kohlberg's Moral Judgment Interviews and standard Issue scoring. Secondary aims were to determine whether the data obtained indicated significant sex differences in level of moral judgment and to compare the mean level of moral judgment of the experimental and control groups with existing research. A statement and motivation of the problem and clarification of concepts were followed by an evaluation of applicable pre-Kohlbergian research, the philosophical foundations of Kohlberg’s theory and the theory itself. This was followed by an examination of the methods of research and the empirical study. The data generated indicated a significant difference in mean level of moral judgment between the research groups in favour of the control group when controlling for age, gender and socio-economic status. This difference was highlighted by comparisons with existing research. No significant gender differences in moral judgment were found. Important conclusions reached were: - Experimental group pupils were retarded in level of' moral judgment and, unlike the pupils in the control group, most had not yet reached stage 3 moral reasoning. - Sex differences in moral judgment were not found as is predicted in Kohlbergian theory (Colby & Kohlberg, 1987: 130). - Sub-group comparisons indicated chronological age to be an important factor in the measurement of moral judgment. The research findings imply that: - Attempts should be made to raise the level of moral judgment of pupils like those in the experimental group specifically, but also that of all pupils. - Planned moral education programmes can ignore sex differences, but not chronological age. - Varied research into moral judgment is necessary. / Dissertation (MEd)--PU for CHO, 1990

Zugl.: Hamburg, Univ., Diss., 2006

Thesis (MA (Teol.))-Universiteit van Pretoria, 2008. / Includes bibliographical references.

Thesis (M.Div.(Kerkgesk.)--Universiteit van Pretoria, 2005. / Includes bibliographical references (leaves 100-104).

Philosophiae Doctor - PhD / It is the aim of this study to determine the location of poverty alleviation within the framework of the church's missionary activity. The following three approaches will be examined, namely a dualistic approach, the approach of liberation theology and a multi-dimensional approach. The author analysed literature of writers within the context of South African missiological discourse. / South Africa

Maatskaplike Werk, as die uiting van n samelewing se bemoeienis met mense in nood, word vir baie dekades reeds deur welsynsinstansies beoefen. Welsynsinstansies is egter nie vir alle persone in nood aanvaarbaar nie, sodat diegene in die middel- en hoer inkomstegroepe nie juis by maatskaplikewerk-hulpverlening uitkom nie. In die VSA is dieselfde verskynsel gehanteer deur die instelling van maatskaplikewerk-privaatpraktyk, wat tans daar n omvangryke en gevestigde hulpverleningstruktuur is. Sedert 1970 het maatskaplike werkers in Suid-Afrika begin om privaatpraktyk te oorweeg en het selfs daarmee begin eksperimenteer. Dog, uiteenlopende standpunte, hetsy evolusionere of revolusionere beskouings, word daaroor gehandhaaf. Die doel van die ondersoeke is dus om te bepaal of privaatpraktyk in Maatskaplike Werk bestaansreg het, of dit beskikbaar en in privaatpraktyk bruikbaar is. Uit die bevindings kan n model vir die instelling en instandhouding van n lewenskragtige praktyk ontwikkel word. Die ondersoek het bestaan uit n literatuurstudie en n empiriese opname in ses stede van die land onder drie teikensisteme, naamlik maatskaplikewerkers (privaatpraktisyns) en nie-privaatpraktisyns) , kliente van welsynsorganisasies en privaatpraktyke en lede van vyf ander hulpprofessies. n Studiereis is na die VSA onderneem om privaatpraktyke te bestudeer en n vergelykingsbasis vir die Suid-Afrikaanse bevindings te kry. Resultate uit die ondersoek dui daarop dat privaatpraktyk, as hulpverleningstruktuur, n realiteit in die maatskaplikewerk- professie is wat nie genegeer kan word nie. Die bestaansreg daarvan is teoreties kwalifiseerbaar, terwyl die nodige sisteme bestaan om maatskaplikewerk-hulpverlening privaat en onafhanklik van welsynsinstansies aan te bied. Privaatpraktisyns verlang n infrastruktuur om hulle dienste beter te organiseer, terwyl 97,8% van die nie-privaat-praktisyns ten gunste van privaatpraktyk is, omdat dit n groter beroepskeuse bied en die professie se selfstandige optrede bevestig. Verbruikers van privaatpraktyk-dienste is oorwegend tevrede, maar as gevolg van beperkte fondse kan die meeste welsynsorganisasie-kliente nie privaatpraktyk-dienste benut nie. Lede van die ander hulpprofessies dra nie voldoende kennis van die maatskaplikewerk-hulpbron nie, maar is oor die algemeen positief daaroor, hoewel net 52,9% voorsien om dit te benut. Indien maatskaplike werkers die nodige opleiding ondergaan, konstruktief beplan, besigheidsbeginsels inkorporeer, die diens bekendstel en kwaliteitdienste lewer, is n lewenskragtige praktyk verseker. / Thesis (DPhil)--University of Pretoria, 1984. / gm2014 / Social Work and Criminology / Unrestricted

The purpose of this study was to examine whether the general expenditure incurred by developers constructing residential units, whereby life rights are exchanged for interest free loans, are deductible in terms of the provisions of the Income Tax Act (58/1962). Furthermore to determine whether the judgement in CSARS v Brummeria Renaissance (Pty) Ltd and others, 2007 (4) All SA 1338 (SCA) 69 SATC 205, and its findings in law and of fact affects the deductibility of expenses incurred by developers, especially in relation to the “amount” and nature of the “amount” in the hands of the taxpayer. The research also sought to determine whether the accounting of amounts in life right exchange agreements, especially as relates to the quantification of such amount, assist in quantifying the amount for tax purposes. The research object was determined by critically analysing the relevant provisions of the ITA (58/1962) with reference to case law and commentators and a critical evaluation of Brummerria Renaissance case supra (2007:205) to determine its affect on the deductibility of the expenses relating to the quantum and nature of the benefit amount received under the life right. Furthermore, an evaluation was done of the relevant accounting standards in relation to the transactional facts to determine whether an alternative valuation model of the benefit is available. It was determined that firstly permissible and then prohibited deductions must be addressed in accordance with the ITA (58/1962). It was further evaluated whether the provision of the right of use, through the life right, can constitute an expense for the developer. It was concluded that incurring general expenses meet the requirements of section 11(a), subject to a single qualification, would be deductible. It was also submitted that the provision of the life right as expenditure should be permissible as deduction against income. However, in both these cases the deductibility in question was held to be subject to the amount received as envisaged in Brummeria Renaissance case supra (2007:205) being revenue in nature. The deductibility of the repair or preparation costs was also examined in terms of section 11(d). The distinction between repair and improvement was discussed and established. It was determined that the determination of when the “income is receivable” was critical in determining the deductibility. It was concluded that this requirement was met if the property was in a condition to receive such income irrespective of whether legal rights to such income had been established at such time that the expenses were incurred. The application of this section is also subject to the amount received, as envisaged in Brummeria Renaissance case supra (2007:205), being revenue in nature. The requirement of “income” is critical in the application of section 11(a) and section 11(d) of the ITA (58/1962), because if the amount is found to be capital in nature no deduction is permissible. The nature of the rights, timing of the accrual and the valuation method of the amount were not decided in the judgement in Brummeria Renaissance case supra (2007:205), and as a result, formed part of the research. The nature of the amount was analysed and it was concluded that the amount was income in nature. The various case law and commentators, including SARS’ IN 58, was also analysed to determine which valuation method of the benefit amount would be the most appropriate in the application of the provisions of the ITA (58/1962). To this extent it was submitted that three possible valuation methods could apply, namely the valuation of the benefit as arms length interest on the loan, the valuation of the benefit as the sale of a usufructuary interest or that the benefit amount could be represented as market related rentals in an arm’s length transaction. It was concluded that in order to determine the value and the timing of the benefit the most suitable valuation method would be to calculate interest on the face value of the loan using a market related interest rate. The benefit would be recognised over the term of the loan by calculating the interest on an annual basis on value of the loan. The various applicable accounting standards were evaluated to determine which best represents the measurement of the benefit as envisaged in Brummeria Renaissance case supra (2007:205). It was concluded that the most appropriate of the various possible accounting standards was IAS 32 which prescribed that the benefit should be determined and valued on a yearly basis in relation to the loan as a financial instrument. It was concluded that the basis for valuing and recognising the benefit for accounting purposes interrelates with the suggested accrual and timing thereof for tax purposes. AFRIKAANS : Die doel van die navorsing was om ondersoek in te stel of die algemene uitgawes aangegaan deur ontwikkelaars in die konstruksie van residensiële eenhede waar lewensregte geruil word vir rentevrye lenings, aftrekbaar sal wees in terme van die bepalings van die Inkomstebelastingwet (58/1962). Daar is verder ook ondersoek ingestel om vas te stel of die uitspraak in Kommisaris van die Suid Afrikaanse Inkomstediens v Brummeria Renaissance (Edms) Bpk en andere, 2007 (4) All SA 1338 (SCA) 69 SATC 205, die aftrekbaarheid van die uitgawes aangegaan deur die ontwikkelaars affekteer, veral in verband met die “bedrag” en aard van die “bedrag” in die hande van die belastingbetaler. Met die navorsing word daar bepaal of die rekeningkundige hantering van bedrae in lewensreg ruilooreenkomste, veral ten opsigte van die kwantifisering daarvan, kan bydrae tot die kwantifisering daarvan vir belastingdoeleindes. Die navorsingsdoelstelling is vasgestel deur die relevante bepalings van die Inkomstebelastingwet (58/1962) met verwysing na hofsake en kommentaar, ‘n kritiese evaluasie van Brummerria Renaissance saak supra (2007:205), om vas te stel wat die uitwerking daarvan is op die aftrekbaarheid van die uitgawes wat verband hou met die hoeveelheid en die aard van die voordeel bedrag ontvang in terme van die lewensreg, asook die evaluering van die relevante rekeningkundige standaarde ten opsigte van die feite van die transaksie om te bepaal of ‘n alternatiewe waardasie model van die voordeel beskikbaar is. Daar is besluit dat die aftrekkings wat eerstens toegelaat en dan verbied word aangespreek moet word in ooreenstemming met die Inkomstebelastingwet (58/1962). Daar is verder bepaal of die voorsiening van die reg om te gebruik deur middel van die lewensreg, ‘n uitgawe in die hande van die ontwikkelaar kan wees. Daar is tot die gevolgtrekking gekom dat die aangaan van algemene uitgawes voldoen aan die vereistes van artikel 11(a) en aftrekbaar is. Dit is ook vasgestel dat die voorsiening van die lewensreg as uitgawe aftrekbaar sal wees teen inkomste. In albei hierdie gevalle is die aftrekbaarheid onderworpe daaraan dat die bedrag ontvang soos vasgestel in Brummeria Renaissance saak supra (2007:205) inkomste van aard is. Die aftrekbaarheid van die herstel- of voorbereidingskostes is ook ondersoek in terme van artikel 11(d). Die onderskeid tussen herstel en verbetering is bespreek en bepaal. Daar is vasgestel dat die bepaling van wanneer die “inkomste ontvangbaar” is, krities is in die bepaling van die aftrekbaarheid daarvan. Daar is tot die gevolgtrekking gekom dat die vereiste nagekom is as die eiendom in ‘n toestand is om inkomste te ontvang ongeag of die reg tot die inkomste bepaal is teen die tyd dat die uitgawes aangegaan is. Die toepassing van hierdie artikel is ook onderworpe daaraan dat die bedrag ontvang soos bepaal in Brummeria Renaissance saak supra (2007:205) inkomste van aard is. Die vereiste van “inkomste” is krities in die toepassing van artikel 11(a) en artikel 11(d) van die Inkomstebelastingwet (58/1962) omrede geen aftrekking toegelaat sal word indien die bedrag kapitaal van aard is nie. Geen besluit is geneem oor die aard van die regte, die tydstip van die toevalling en die waardasiemetode van die bedrag in die uitspraak in Brummeria Renaissance saak supra (2007:205), en as gevolg daarvan vorm dit deel van die navorsing. ‘n Analise van die aard van die bedrag is gedoen en daar is tot die gevolgtrekking gekom dat die bedrag inkomste van aard is. Die verskillende hofsake en kommentaar, insluitende SARS se IN 58, is ook analiseer om te bepaal watter waardasiemetode van die voordeel mees gepas sal wees in die toepassing van die Inkomstebelastingwet (58/1962). Tot hierdie mate is dit aanvaar dat daar drie moontlike waardasiemetodes van toepassing kan wees, naamlik die waardasie van die voordeel op die lening in ‘n armslengte transaksie, die waardasie van die voordeel as die verkoop van ‘n vruggebruik of die voordeel van die bedrag kan verteenwoordig word deur die markverwante huurinkomste in ‘n armslengte transaksie. In bepaling van die waarde en die tydstip van die voordeel is die gevolgtrekking gemaak dat die mees gepaste waardasiemetode sal wees om rente op die sigwaarde van die lening te bereken deur ‘n markverwantrentekoers te gebruik. Die voordeel sal dan erken word oor die tydperk van die lening deur die die rente jaarliks te bereken op die waarde van die lening. Die verskillende rekeningkundige moontlikhede is ondersoek om die metode te bepaal wat waardasie van die voordeel soos in Brummeria Renaissance saak supra (2007:205) die beste verteenwoordig. Daar is tot die gevolgtrekking gekom dat die mees gepaste rekeningkundige standpunt IAS 32 is waarvolgens die voordeel op ‘n jaarlikse basis bepaal word in verhouding met die lening as ’n finansiële instrument. Daar is tot die gevolgtrekking gekom dat die metode van die waardasie en erkenning van die voordeel vir rekeningkundige doeleindes regstreeks verband hou met die voorgestelde toevalling en tydstip daarvan vir belastingdoeleindes. Copyright / Dissertation (MCom)--University of Pretoria, 2012. / Taxation / unrestricted