• Refine Query
  • Source
  • Publication year
  • to
  • Language
  • 66
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • Tagged with
  • 70
  • 70
  • 57
  • 46
  • 12
  • 11
  • 10
  • 8
  • 8
  • 8
  • 7
  • 7
  • 7
  • 7
  • 6
  • About
  • The Global ETD Search service is a free service for researchers to find electronic theses and dissertations. This service is provided by the Networked Digital Library of Theses and Dissertations.
    Our metadata is collected from universities around the world. If you manage a university/consortium/country archive and want to be added, details can be found on the NDLTD website.
11

Complexos macromoleculares da via específica de incorporação de selênio de Escherichia coli / Macromolecular assemblies of selenium incorporation specific pathway in Escherichia coli

Serrão, Vitor Hugo Balasco 14 February 2013 (has links)
A existência de uma maior variedade de aminoácidos codificados pelo código genético tem estimado estudos sobre os mecanismos de síntese, reconhecimento e incorporação desses resíduos nas cadeias polipeptídicas nascentes. Um exemplo é a via de incorporação de selenocisteína evento cotraducional dirigido pelo códon UGA. Em bactérias, essa via conta com uma complexa maquinaria molecular composta por: Selenocisteína Sintase (SelA), Fator de Elongação Específico de Reconhecimento (SelB), Selenofosfato Sintetase (SelD), tRNA específico (SelC ou tRNAsec), sequência específica no mRNA (Sequência de Inserção de Selenocisteínas - SECIS) e Aminoacil tRNA Sintetase (aaRS). Pelo fato do selênio ter uma toxicidade elevada em ambientes celulares, é fundamental a compreensão do mecanismo catalítico e razão estequiométrica na formação dos complexos da via na etapa de incorporação junto ao tRNAsec, bem como sua caracterização estrutural foram os objetivos deste trabalho. A proteína SelA foi expressa e purificada para utilização em análises envolvendo microscopia de força atômica, microscopia eletrônica de transmissão com contraste negativo e em gelo vítreo foram realizadas nos complexos SelA e SelA-tRNAsec, visando obter um modelo estrutural e a razão estequiométrica dos complexos. A fim de compreender o mecanismo de passagem do selênio, ensaios de anisotropia de fluorescência e de microcalorimetria, corroborados pelas análises de troca de hidrogênio-deutério acoplado a espectrometria de massa e espectroscopia de infravermelho, elucidaram a formação e estequiometria do complexo ternário SelAtRNA sec-SelD. Tentativas de cristalização e análises cristalográficas também foram realizadas, no entanto, sem sucesso. Com os resultados obtidos foi possível propor que o reconhecimento de SelD e, consequentemente, a entrega do selenofosfato, seja uma etapa crucial da via de incorporação de selenocisteínas. / The existence of a greate variety of amino acids encoded by the genetic code has stimulated the study of the mechanisms of synthesis, recognition and incorporation of these residues in the nascent polypeptide chains. An example of genetic code expansion is the selenocysteine incorporation pathway an event cotraducional by the UGA codon. In bacteria, this pathway has a complex molecular machinery comprised: Selenocysteine Synthase (SelA), Specific Elongation Factor (SelB), Selenophosphate Synthetase (SelD), tRNA-specific (SelC or tRNAsec), Specific mRNA Sequence (SElenocysteine Insertion Sequence - SECIS) and Aminoacyl tRNA Synthetase (aaRS). Because selenium has high toxicity in cellular environments; it is essential for cell survival the association of this compound with proteins, in this case, selenoprotens and the associated proteins involved in the selenocysteine synthesis. Therfore the understanding of the catalytic mechanism, stoichiometric ratio, protein complex formation with the tRNAsec, and its structural characterization were the objectives of this work. The SelA protein was expressed and purified to used in analyzes involving atomic force microscopy, transmission electron microscopy with negative stain and in vitreous ice were performed in the complex SelA and SelA-tRNAsec in order to obtain a structural model of the complex and the stoichiometric ratio of its components. To study the selenium association with protein of the synthesis pathway, fluorescence anisotropy assays and isothermal titration calorimetry corroborated by the analysis hydrogen-deuterium exchange coupled to mass spectrometry and infrared spectroscopy were employed.Crystallization attempts were made and preliminary crystallographic analyzes were also performed, however, so far unsuccessfuly. The results obtained were possible to develop the hypothesis about the SelD recognition and, consenquently, the selenophosphate delivery, a crucial stage of the selenocysteine incorporation pathway.
12

Interação de pequenas moléculas com proteínas: um estudo usando métodos convencionais e transferência de saturação de R.P.E. / On the interaction of small molecules with proteins: a conventional EPR and ST-EPR study

Ruggiero Neto, Joao 20 June 1984 (has links)
Neste trabalho, analisamos a interação de pequenas moléculas, marcadores hidrofóbicos, com hemoglobina, em diferentes estados: monocristal, pó e solução aquosa. Os métodos de análise empregados, são baseados nas teorias de relaxação em líquidos e técnicas não lineares de ressonância ST-RPE (transferência de saturação), fornecendo informações sobre mudanças locais nas vizinhanças desses marcadores. Um dos marcadores hidrofóbicos, o TEMPO, mostrou uma anisotropia considerável nos espectros de RPE do monocristal de hemoglobina que está relacionado com o empacotamento molecular da proteína do cristal. A associação desses métodos de análise conduziu a importantes informações sobre mudanças na camada de hidratação em várias proteínas: hemoglobina, mioglobina e lisozima, monitoradas pelo marcador covalente derivado da maleimida, e induzidas pela temperatura, sob diferentes condições de hidratação. Desta forma o uso da espectroscopia de RPE especialmente com simulação espectral e DT-RPE mostro ser um método potente e ainda não explorado no estado de hidratação de proteínas / In this work, the interactions of small molecules, hydrophobic spin labels, with hemoglobin, under different states was analysed: single crystal, powder and aqueous solution. The methods of analysis employed, are based in relaxation theory in liquids and non-linear techniques, saturation transfer (ST-EPR), giving informations on the local changes in neighbourhood of the labels. One of the hydrophobic labels, TEMPO, showed a considerable anisotropy in the hemoglobin single crystal spectra, a result related to the molecular packing in the protein single crystal. The association of the techniques of analysis all together lead to important informations an temperature induced changes in the hydration layer in several proteins: hemoglobin, myoglobin, NEM*, a maleimide derivated, in different conditions of hydration. In this way the use of EPR spectroscopy and particularly with spectral simulations and ST-EPR, proved to be a powerful and not yet very much explored method to study the problem of protein hydration
13

Interação não canônica entre septinas: a análise da interação na interface G entre SEPT3 e septinas do grupo II / Non-canonical septins interactions: analysis of the interaction via G interface of SEPT3 and group II septins

Lanzoni, Paola 26 May 2017 (has links)
As septinas compõem o quarto componente do citoesqueleto das células eucarióticas, atrás da actina, miosina e filamentos intermediários. São proteínas filamentosas que se arranjam em forma de fibras e anéis, desempenhando um papel estrutural na célula. Os seres humanos expressam 13 septinas, que são divididas em 4 grupos diferentes de acordo com sua estrutura primária: grupo I (SEPT3, SEPT9, SEPT12); grupo II (SEPT6, SEPT8, SEPT10, SEPT11, SEPT14); grupo III (SEPT1, SEPT2, SEPT4, SEPT5) e grupo IV (SEPT7), sendo que SEPT13 foi caracterizada como um pseudogene de SEPT7. O filamento fisiológico mais bem estudado é composto por SEPT2-SEPT6-SEPT7-SEPT9 (nesta exata sequência), e é usado como a base para a descrição da formação canônica, onde se acredita que septinas do mesmo grupo ocupam o mesmo lugar no filamento. Entretanto, ensaios de duplo-híbrido identificaram muitas interações não canônicas inesperadas entre septinas como SEPT9-SEPT6 e SEPT9-SEPT8, sugerindo estes também possam existir in vivo. Além destes, estudos mostraram a existência de interações entre septinas do grupo I e grupo II, e especialmente no caso SEPT11-SEPT12, a interação deixa de existir ao inserir uma mutação sítio-dirigida na interface G destas proteínas. O presente trabalho investiga a interação entre SEPT3, uma septina do grupo I, com todas aquelas do grupo II. Esta interação foi estudada por análises de coexpressão e copurificação em resina de afinidade ao cobalto, onde apenas a SEPT3 possuía uma extensão de seis histidinas em seu N-terminal. Esta primeira análise mostrou que SEPT3 não foi copurificada com todos os membros do grupo II dando uma clara evidência de variação de afinidade dentro do grupo. Usando esta abordagem, SEPT6, SEPT10 e SEPT14 não mostraram interação com SEPT3, enquanto SEPT8 e SEPT11 copurificaram com SEPT3, mas não em concentrações estequiométricas. Para os complexos SEPT3-SEPT8 e SEPT3-SEPT11, uma segunda etapa de purificação foi realizada por meio de cromatografia de exclusão molecular, onde um pico de grande variância em relação à média indicou um valor de massa molecular entre monômeros e dímeros. Os mesmos, quando avaliados por espalhamento de luz a múltiplos ângulos mostraram variação na massa molecular ao longo do pico de eluição conforme ele era eluído. Tal variação era compatível com a eluição de dímeros no início até monômeros no final. Os estudos da interação entre SEPT3-SEPT8 por ultracentrifugação analítica indicou uma tendência de associação em altas concentrações das proteínas, compatível com a constante de dissociação determinada por termoforese em microescala, na ordem de dezenas de micromolar. Tais resultados levantaram questões acerca da relevância fisiológica destes complexos e reforçam a importância de um estudo mais aprofundado na formação dos complexos não canônicos de septinas para o desenvolvimento celular. / The septins are accepted to be the fourth cytoskeleton component of the eukaryotic cells, after actin, myosin and intermediate filaments. They are filament forming proteins that are organized in fibers and rings, having a structural role in the cell. Humans express 13 septins, which are divided into 4 different groups according to their primary structure: group I (SEPT3, SEPT9, SEPT12); group II (SEPT6, SEPT8, SEPT10, SEPT11, SEPT14); group III (SEPT1, SEPT2, SEPT4, SEPT5) e group IV (SEPT7). SEPT13 was later characterized as a SEPT7 pseudogene. The best characterized filament is built up from SEPT2-SEPT6-SEPT7-SEPT9 (in this exact sequence), and is used as a basis for the description of the so-called canonical arrangement, which accepts that septins from the same group can occupy the same position within the filament. However yeast two-hybrid assays identified several unexpected interactions such as SEPT9-SEPT6 and SEPT9-SEPT8, raising the possibility that these could also exist in vivo. Furthermore, studies have shown the existence of interactions between group I and group II, and especially in the SEPT11-SEPT12, the interaction dissolves when a mutation in the G interface is inserted. The present work investigates the interaction between SEPT3, a group I septin, with all of those from group II. This interaction was studied through co-expression and co-purification methods using metal affinity chromatography, where only the SEPT3 contained the six histidines extention. This initial analysis showed that SEPT3 did not co-purify with all group II members, clearly pointing to variability in the affinity within group. Using this approach SEPT6, SEPT10 e SEPT14 showed no interaction with SEPT3, whilst SEPT8 and SEPT11 co-purified with SEPT3, but not in stoichiometric concentrations. For the SEPT3-SEPT8 and SEPT3-SEPT11 complexes, a second purification stage was performed using size exclusion chromatography, where a broad peak was observed corresponding to a molecular mass value which was intermediate between a dimer and a monomer. The same complexes, when evaluated by multiple angle light scattering revealed a variation in the molecular mass across the peak as it eluted. Such variation was compatible with elution of dimers at the beginning and monomers at the end. Studies for the SEPT3-SEPT8 interaction via analytical ultracentrifugation suggested a trend to associate in high protein concentration, consistent with the dissociation constant found by microscale thermophoresis, which was of the order of ten micromolar. The results raise questions concerning the physiological relevance of these complexes and reinforce the importance of further studies on the non-canonical assembly of septin complexes for cellular development.
14

Implementação de uma abordagem híbrida utilizando modelagem comparativa e ab initio para predição de estruturas tridimensionais de proteínas contendo múltiplos domínios com conectores flexíveis / Implementation of a hybrid approach using comparative and ab initio modelling to predict the three dimensional structure of proteins containing multiple domains and flexible connectors

Honorato, Rodrigo Vargas 17 November 2015 (has links)
Domínio proteico é uma sequência de aminoácidos evolutivamente conservada e funcionalmente independente. Um dos aspectos mais importantes do estudo de uma proteína que contem múltiplos domínios é o entendimento da comunicação, entre os diferentes domínios, e seu papel biológico. Essa comunicação em maior parte é feita pela interação direta entre domínios. A interação poderia ser tratada como uma clássica interação proteína-proteína. Entretanto, proteínas multidomínio possuem restrições determinadas por suas regiões conectoras. Os conectores interdomínio impõem restrições e limitam espaço conformacional dos domínios. Apresentamos aqui o MAD, uma rotina capaz de obter modelos tridimensionais de alta resolução para proteínas, contendo qualquer número de domínios, a partir de sua sequencia primária. Os domínios conservados são identificados utilizando a base de domínios conservados (CDD) e seus limites são utilizados para definir as regiões conectoras. É criado um ensamble de possíveis dobramentos dos conectores e sua distribuição de distâncias C/N-terminais são utilizadas como restrição espacial na busca pela interação entre os domínios.Os modelos dos domínios são obtidos por uma modelagem comparativa. Foi implementada uma heurística, capaz de lidar com a natureza combinatorial dos múltiplos domínios e com a necessidade imposta pela limitação computacional de realizar o docking dos domínios em forma de pares. Todas combinações de domínios são submetidas as rotinas de docking. Aplica-se filtro de distância e energético, excluindo as conformações que apresentam distância C/N-terminal entre domínios maior do que o valor máximo observado no ensamble de conectores e seleciona as conformações energeticamente mais favoráveis. As conformações são submetidas a uma rotina de agrupamento hierárquico baseada em sua similaridade estrutural. Para a segunda fase as conformações selecionadas são pareadas com seu domínio complementar e ressubmetidas a rotina de docking até que todas as fases tenham sido completadas. Foi criado um conjunto de testes a partir do Protein Data Bank contendo 54 proteínas multidomínio para que a rotina de docking do MAD fosse comparada com outros softwares utilizados pela comunidade cientifica, mostrou-se superior ou equivalente aos métodos testados. A capacidade de utilizar dados experimentais foi demostrada através da proposição de um modelo da forma ativa da enzima tirosina fosfatase 2, nunca observado experimentalmente. A rotina de docking foi expandida paralelamente em uma aplicação standalone e utilizada na resolução de diversos problemas biológicos. Concluímos que a inovação metodológica proposta pelo MAD é de grande valia para a modelagem molecular e tem potencial de gerar uma nova perspectiva a respeito da interação de proteína multidomínio, visto que é possível analisar essas proteínas em sua plenitude e não como domínios separados. / Protein domain is an evolutionary conserved and functionally independent amino acid sequence. One of the most important aspects of the study of a protein that contains multiple domains is the understanding of communication between the different areas, and their biological role. This communication is made mostly by direct interaction between domains. The interaction could be treated as a classical protein-protein interaction. However, multidomain proteins have certain restrictions for its connector regions. The intra connectors impose restrictions and limit conformational space of the domains. We present the MAD, a routine able to get three-dimensional models of high-resolution protein, containing any number of domains, from its primary sequence. The conserved domains are identified using the basic conserved domains database (CDD) and its boundaries are used to define the connector regions. This creates a ensemble of possible folding of the connectors and distribution of distances C/N-terminals are used as spatial restriction in the search for interaction between domains.Os models of the domains are obtained by comparative modelling. A heuristic able to handle the combinatorial nature of the multiple areas and the need imposed by the computer to perform the limitation of the docking areas as pairs was implemented. All combinations of domains are referred to the docking routines. Distance and energy filters are applied, excluding conformations that have C/N-terminal domains distances larger than the maximum value observed in the connectors ensemble and selects the most favourable energy conformations. Conformations are subjected to hierarchical clustering routine based on their structural similarity. For the second phase, the selected conformations are paired with its complementary domain and resubmitted to the docking routine until all phases have been completed. A test set has been created from the Protein Data Bank containing 54 multidomain proteins so that the docking routine of MAD could be compared with other software used by the scientific community, it has been shown to be superior or equivalent to the tested methods. The ability to use experimental data was demonstrated by proposing a model of the active form of tyrosine phosphatase enzyme 2, never observed experimentally. The docking routine was expanded in a standalone application and used in solving various biological problems. We conclude that the methodological innovation proposed by the MAD is very useful for molecular modelling and has the potential to generate a new perspective on multidomain protein interaction as you can analyse these proteins in its entirety and not as separate domains.
15

Analisando a determinação sexual de vertebrados com base em redes de interação entre proteínas /

Valente, Guilherme Targino. January 2013 (has links)
Orientador: Cesar Martins / Coorientador: Ney Lemke / Banca: Antonio Sérgio Kimus Braz / Banca: José Luiz Rybarczyk Filho / Banca: Reinaldo Otávio Alvarenga Alves de Brito / Banca: Pedro Manuel Galetti Junior / Resumo: Atualmente os sistemas biológicos vem sendo abordados por diversas áreas de pesquisas, dentre elas a biologia de sistemas. Essa área tem centrado esforços para descrever e compreender as relações entre os componentes bióticos e abióticos desses sistemas, utilizando para isso a teoria de grafos. Uma forma de estudar esses sistemas, é avaliar as interações entre proteínas, que são as interações biomoleculares mais abundantes nas células. Nesse contexto, a presente tese focou no desenvolvimento de um algoritmo computacional capaz de predizer interações entre proteínas de qualquer espécie ou conjunto protéico. Para isso, foram utilizadas técnicas de aprendizado de máquina (sub-área da inteligência artificial) para a construção e aplicação desse preditor, o qual mostrou-se eficaz em predizer interações entre proteínas de mais de 80 espécies diferentes, incluindo interações entre proteínas de parasita e hospedeiro. Esse novo preditor foi aplicado no proteoma de zebrafish (Danio rerio) e humanos (Homo sapiens), gerando assim redes de interações proteicas para ambas as espécies. As interações obtidas foram avaliadas em um contexto geral e o foco das análises foi direcionado para a sub-rede relacionada com as vias de determinação e diferenciação sexual em vertebrados. Os resultados demonstraram uma relativa baixa conservação desses grafos ao longo da evolução dos vertebrados, tanto do ponto de vista global quanto da sub-rede relacionada com a determinação e diferenciação sexual em vertebrados. Além disso, foi possível observar ao menos um hub conservado entre as duas sub-redes, o qual representa um novo alvo a ser avaliado por pesquisas experimentais. Contudo, os dados demonstram que o preditor gerado possui um grande potencial para diversas áreas de estudos e é bastante útil para predição de interações em larga-escala. Além disso, os aspectos evolutivos aqui ... / Abstract: Nowadays the biological systems have been analyzed under several research foci, including the system biology. This area focus to describe and understand the relationship between biotic and abiotic factors using the graph theory. The protein interactions are target interactions to the system biology because they are the most abundant biomolecular interactions within a cell. Thus, this thesis reported the development of a computational algorithm to predict proteinprotein interactions for all species or protein sets. The machine learning technique (sub-area of artificial intelligence) were used to develop and apply this method, giving effective results to predict protein-protein interaction for more than 80 different species, including parasitehost associations. This new predictor was applied to the proteome set of zebrafish (Danio rerio) and humans (Homo sapiens), generating the protein-protein interactions for both species. Evolutionary aspects of the protein interactions were studied in a broad context and the focus was directed to the sub-network involved in the vertebrate sex determination and differentiation. The results reported a low conservation of those graphs across the evolution in a general view or for the sub-network related to the vertebrate sex determination and differentiation. Moreover, it was reported at least one conserved hub between both subnetworks, to be further evaluated by experimental procedures. Anyway, the data showed that the predictor here reported may be very useful for several research areas and it is desirable for large-scale prediction procedures. Furthermore, the evolutionary aspects discussed in this thesis open new perspectives concerning system biology and evolutionary pathways of vertebrate sex determination and differentiation / Doutor
16

Análise da especificidade do tRNASec entre o fator de elongação específico para selenocisteínas (SelB) e Seril-tRNA Sintetase (SerRS) de Escherichia coli / The tRNASec specific interaction of Escherichia coli Selenocysteine Elongation Factor (SelB) and Seryl-tRNA Synthetase (SerRS)

Adriano de Freitas Fernandes 21 February 2017 (has links)
A selenocisteína (Sec, U) é o aminoácido que representa a principal forma biológica do elemento selênio e sua incorporação é um processo co-traducional em selenoproteínas como resposta ao códon UGA em fase e requer uma complexa maquinaria molecular. O repertório completo de genes envolvidos nessa via de síntese em procariotos é conhecido, porém algumas das interações moleculares ainda não foram totalmente esclarecidas. Este projeto visa à caracterização molecular nas interações entre o Fator de Elongação específico para incorporação de Sec (SelB) e Seril-tRNA sintetase (SerRS) com distintas construções do tRNASec de Escherichia coli afim de compreender a sua especificidade, seletividade e ordem de eventos. Para isso, medidas de Espectroscopia de Anisotropia de Fluorescência (FAS), Ultracentrifugação Analítica (AUC) e Calorimetria de Varredura Diferencial (DSC) foram utilizadas para determinação das constantes de interação desses complexos proteína-tRNA. Além disto, experimentos de Espalhamento de Raios-X a baixo ângulo (SAXS) e Microscopia eletrônica de transmissão por contraste negativo (NS-EM) foram realizados para elucidação estrutural destes complexos. Os estudos propostos irão auxiliar no entendimento do mecanismo de incorporação e de especificidade do tRNA para este aminoácido em bactérias bem como nos demais domínios da vida além de possibilitar um aumento na compreensão de complexos do tipo proteína-tRNA bem como salientar a importância dos elementos estruturais do tRNA para sua especificidade no processo de síntese de novas proteínas. / Selenocysteine (Sec, U) is an amino acid that represents the main biological form of the selenium element and its incorporation is a co-translational process in selenoproteins in response to the in-phase UGA codon and requires complex molecular machinery. The complete repertoire of genes involved in this pathway of synthesis in prokaryotes is known, although some of the molecular interactions have not yet been fully elucidated. This project aims at the molecular characterization in the interactions between the specific elongation factor for the incorporation of Sec (SelB) and Seril-tRNA synthase (SerRS) with different constructions of tRNASec from Escherichia coli in order to their specificity, selectivity and order of events. For this, measurements using Fluorescence Anisotropy Spectroscopy (FAS), Analytical Ultracentrifugation (AUC) and Differential Scanning Calorimetry (DSC) were employed to determine the interaction constants of the protein-tRNA complexes. In addition, Small Angle X-Ray Scattering (SAXS) experiments and negative stain transmission electron microscopy (NS-EM) were performed for structural elucidation of these complexes. The proposed studies will help to understand the mechanism of tRNA incorporation and specificity for this amino acid in bacteria as well as other domains of life. In addition, it allows an increase in the understanding of protein-tRNA-like complexes as well as emphasizing the importance of structural elements of tRNA for its specificity in the process of synthesis of new proteins.
17

Evolução convergente da protease FtsH5 de Arabidopsis thaliana e seu regulador negativo putativo FIP (FtsH5 interacting protein) / Convergent evolution of Arabidopsis thaliana FtsH5 protease and its putative negative regulator FIP (FtsH5 interacting protein)

Silva, Marcos Araújo Castro e 02 March 2015 (has links)
As metaloproteases AAA/FtsH são componentes chave do controle da qualidade das proteínas inseridas nas membranas de mitocôndrias e cloroplastos. Em Arabidopsis thaliana, as proteases FtsH presentes nas membranas dos tilacóides formam um complexo heterohexamérico composto pelas subunidades FtsH1/FtsH5 (tipo A) e FtsH2/FtsH8 (tipo B). Este complexo está envolvido na reciclagem de proteínas foto-danificadas, especialmente da proteína D1, centro de reação do PSII. Algumas linhas de evidências indicam ainda que existe um limiar de concentração das proteases FtsH, necessário para a correta formação e desenvolvimento dos cloroplastos. Apesar da extensiva caracterização genética e molecular das proteases FtsH, o mecanismo regulatório do complexo FtsH dos cloroplastos não foi totalmente elucidado até o momento, contudo existem evidências de que a sua ativação pode estar relacionada a alta incidência luminosa e a outras condições de estresse. A presença de fatores proteicos auxiliares, foi testada como hipótese alternativa por nosso grupo, através do uso da protease FtsH5 como isca em um ensaio de duplo híbrido de leveduras. Este ensaio identificou uma proteína interagente putativa, nomeada FIP (FtsH5 Interacting Protein), a qual comprovadamente interage com FtsH5 e está localizada nas membranas dos tilacóides. De modo a investigar o papel regulatório putativo de FIP sobre a atividade do complexo FtsH, nós analisamos os padrões de expressão em uma ampla gama de condições de estresse a partir de dados públicos de microarranjos de DNA. Os perfis de expressão indicam que FIP pode ser um regulador negativo da atividade do complexo. Os resultados também sugerem que o complexo pode estar envolvido na resposta do cloroplasto a diferentes tipos de condições de estresse. O estudo da história evolutiva das proteínas interagentes FtsH5 e FIP evidenciou que as sequências homólogas a FIP são encontradas exclusivamente em musgos e plantas superiores, sugerindo assim que a origem de FIP pode estar relacionada a colonização terrestre. Todos os genes codificantes das proteases FtsH do complexo foram usados como \"query\" na busca por sequências homólogas, permitindo a classificação das proteases FtsH nos tipos A e B por inferência filogenética Bayesiana. Análises filogenéticas Bayesianas também foram feitas para FIP e as proteases FtsH tipos A e B, independentemente. A análise Mirrortree suportou a existência de coevolução entre FIP e as proteases FtsH tipo A. Por outro lado, nenhuma correlação foi encontrada entre FIP e as proteases FtsH tipo B, o que corrobora nossas observações experimentais anteriores. Além disso, o agrupamento portador de homólogos FIP pôde ser recuperado em uma filogenia mais completa das proteases FtsH do tipo A. Análises subsequentes mostraram que ambas as proteínas interagentes estão extensivamente sobre seleção negativa e que proteases FtsH tipo A são bastante conservadas, principalmente nos seus domínios internos. / Eukaryotic AAA/FtsH metalloproteases display a key role in the protein quality control of membrane-inserted proteins in mitochondria and chloroplasts. In Arabidopsis thaliana, chloroplast thylakoidal membranes FtsH proteases form a heterohexameric complex made by FtsH1/FtsH5 (type A) and FtsH2/FtsH8 (type B) subunits. This complex is involved in protein turnover of photo-damaged proteins, in particular the D1 protein at the PSII reaction center. Several lines of evidence also indicate that a FtsH threshold level is necessary for the proper formation and development of chloroplasts. Despite extensive genetic and molecular characterization of the FtsH proteases, the regulatory mechanism of the FtsH complex in chloroplasts has not yet been fully elucidated, however, there are evidences that its activation might be related to high light incidence and other stress conditions. The presence of auxiliary protein factors, as an alternative hypothesis, was tested by our group, through the use of the protease FtsH5 as bait in a yeast two-hybrid assay. This essay identified a putative interacting protein named FIP (FtsH5 Interacting Protein), which has been proved to interact with FtsH5 and be located at the thylakoid membranes. In order to investigate a putative regulatory role of FIP on FtsH complex activity, we analyzed gene expression patterns in a wide range of stress conditions from public DNA microarray data. The expression profiles indicate that FIP could be a negative regulator of the FtsH complex activity. The results also suggest that the complex may be involved in the chloroplast response to different types of stress conditions. In order to shed some light on the evolutionary history of FtsH5 and FIP interacting proteins, we have shown that FIP\'s homologous sequences were exclusively found in mosses and higher plants, suggesting that FIP origin might be related to the plant terrestrial colonization. All Arabidopsis FtsH complex-encoding genes were used as \"query\" sequences in search for homologous sequences, allowing us to classify the FtsH proteases in type A and B by Bayesian phylogenetic inference. Bayesian phylogenetic analyses were also run for FIP and FtsH types A and B proteases, independently. Mirrortree analysis supported coevolution between FIP and type A FtsH proteases. On the other hand, no correlation was found between FIP and type B FtsH homologues, which support our previous experimental observations. In addition, the FIP bearing cluster could be recovered in a more complete type A FtsH phylogeny. Subsequent analyzes have shown that both interacting proteins are extensively under negative selection and that type A FtsH are very conserved, mainly in its inner domains.
18

Identificação de proteínas do hospedeiro que interagem com a proteína NSP do geminivirus / Identification of host proteins which interact with the geminivirus NSP protein

Mariano, Andréa Cristina 08 October 2002 (has links)
Submitted by Marco Antônio de Ramos Chagas (mchagas@ufv.br) on 2017-05-11T15:54:37Z No. of bitstreams: 1 texto completo.pdf: 1901797 bytes, checksum: e289fb49d5428280315e56aaa1136a67 (MD5) / Made available in DSpace on 2017-05-11T15:54:37Z (GMT). No. of bitstreams: 1 texto completo.pdf: 1901797 bytes, checksum: e289fb49d5428280315e56aaa1136a67 (MD5) Previous issue date: 2002-10-08 / Conselho Nacional de Desenvolvimento Científico e Tecnológico / A família Geminiviridae é uma família de vírus de planta constituída por vírus compostos por genoma circular de DNA fita simples que utilizam fatores do hospedeiro tanto para sua replicação quanto para a translocação do genoma viral no hospedeiro. Com a finalidade de identificar fatores do tomateiro que interagem com as proteínas virais do geminivírus TGMV (Tomato golden mosaic virus), foi utilizado o sistema duplo híbrido para escrutínio de proteínas positivas quanto à interação. As regiões codificadoras das proteínas MP, NSP e REn foram amplificadas e inseridas, individualmente, no vetor pBDGAL4 Cam, fusionadas ao domínio de ligação ao DNA do gene GAL4. Paralelamente foi construída uma biblioteca de cDNA de tomateiro, propagada em vetor de S. cerevisae derivados de lambda ZAPII. O escrutínio da biblioteca de cDNA assim como os ensaios funcionais de identificação de interação entre proteínas geminivirais foram conduzidos no sistema duplo-híbrido de leveduras. Ao contrário das proteínas MP e NSP, a proteína viral REn apresentou a capacidade de ativar a transcrição quando fusionada ao domínio de ligação ao DNA, o que impossibilitou seu uso como isca em ensaios de interação proteína-proteína por esse sistema. A expressão correta das proteínas de movimento MP e NSP, direcionada pelos vetores do sistema duplo-híbrido, foi comprovada pela capacidade das proteínas recombinantes em interagirem ativando os genes repórteres. A interação entre MP e NSP, identificada no presente trabalho, está coerente com os modelos propostos para movimento de geminivírus no hospedeiro, os quais sugerem a interação entre essas duas proteínas durante o processo de translocação do genoma viral. A proteína NSP foi então utilizada como isca nos ensaios de interação proteína-proteína, utilizando como alvo as proteínas codificadas pela biblioteca de cDNA de tomateiro. Como resultado do escrutínio da biblioteca de cDNA de tomateiro, foram identificados cinco cDNAs que codificam proteínas capazes de interagir com NSP com diferentes intensidades, conforme demonstrado em ensaios quantitativos da atividade do gene repórter β-galactosidase. A análise de seqüência e do padrão de restrição desses clones demonstraram que quatro deles eram idênticos e codificavam um domínio conservado de quinase serina/treonina, sendo denominado NIK (NSP - Interacting Kinase). Evidências indicam que, provavelmente, a interação entre NIK e NSP seja funcional. Análise da estrutura primária de NSP demonstrou a presença de resíduos de serina e treonina em contexto favorável para fosforilação. Além disso, NIK não foi capaz de interagir com outras proteínas virais e com controles, pelo sistema duplo híbrido, confirmando a especificidade da interação NSP-NIK. A análise comparativa da seqüência parcial do cDNA de NIK com seqüências de cDNAs de uma biblioteca de semente de soja mostrou que a proteina NIK possui cerca de 92% de similaridade de seqüência, na região carboxiterminal, com uma proteína quinase de soja. A quinase identificada em soja, denominada GmNIK (Glicine max NIK), contém 623 resíduos de aminoácidos e uma massa molecular estimada em 68586,10 kDa e foi capaz de interagir com NSP por meio do sistema duplo híbrido. GmNIK possui, além do domínio de quinase um domínio de ligação a ATP 309 419 IIHRDVKAANILL 431 , LGKGFGNVYKKGVFPDGTLVAVKK 332 , uma hélice transmembrana, provavelmente responsável pela inserção da proteína na 96 membrana plasmática, e regiões ricas em leucina, LTNQIVLLQNNNISGPIPSELGKLKLTQLDLSNNFFSGGIPPSLGHL 167 como 144 e 192 MTQLNFLDLSYNNLSGPVPRILAKS . Os domínios encontrados em GmNIK são característicos de proteínas codificadas por genes de resistência e de receptores de membrana envolvidos em programas de desenvolvimento. A predição do modelo topológico de GmNIK baseado em sua estrutura modular, similar `aquela da proteína codificada pelo gene de resistência Xa21, sugere a posição intracelular do domínio de quinase e do domínio de ligação a nucleotídeo, enquanto que as regiões ricas em leucina são voltadas para o meio extracelular. A posição intracelular do domínio de quinase está coerente com a hipótese de interação funcional entre GmNIK e NSP, uma vez que NSP localiza- se no meio celular interno. Ensaios adicionais deverão ser conduzidos para confirmar se a proteína viral NSP é fosforilada por NIK in vitro e in vivo. / Geminiviridae is a family of plant viruses comprised by viruses with a circular single stranded DNA genome that utilizes host factors for replication and viral genome translocation. In order to identify factors in tomato plants which interact with viral proteins of the geminivirus TGMV (Tomato golden mosaic virus), the yeast two-hybrid system was used to screen for proteins with a positive interaction. Coding regions of the proteins MP, NSP and REn were amplified and inserted, individually, within the vector pBDGAL4 Cam, and merged to the DNA binding domain of the GAL4 gene. Additionally, a library of tomato cDNA was obtained and propagated in a S. cerevisae vector derived from lambda ZAPII. The cDNA library screening and all functional assays developed to identify the interaction among geminiviral proteins were carried out in the yeast two-hybrid system. Differently from the MP and NSP proteins, the REn viral protein was able to activate the transcription when merged to the DNA binding domain. Therefore, it was impossible to use the REn viral protein as an bait in protein-protein interaction assays by this system. The correct expression of the movement proteins MP and NSP, directed by the two-hybrid vectors, was demonstraded by the interaction capacity of recombinant proteins, activating its reporting genes. The interaction between MP and NSP, identified in the present work, is consistent with the models that describe the geminivirus movement within the host, which suggest the interaction between these two proteins during the viral genome translocation. The NSP protein was utilized as bait in the protein-protein interaction assays, using as target proteins codified by the tomato cDNA library. The screeninf of the library resulted in the identification of five cDNAs that code for proteins capable of interacting with NSP with different intensities, according to the quantitative assays of the reporter gene β-galactosidase. Analyses of the sequence and the restriction patterns of these clones demonstrated that four of them were identical and code for a conserved serine/threonine kinase domain, named NIK (NSP - Interacting Kinase). Evidence indicates that the interaction between NIK and NSP is probably functional. The analysis of the NSP primary structure showed the presence of serine and threonine residues suitable to phosphorylation. Besides, NIK was not able to interact with other viral proteins and with controls using the two-hybrid system, corroborating the specificity of the NSP-NIK interaction. The comparative analysis of the NIK s cDNA partial sequence with cDNAs provided from a soybean library showed that the NIK protein has a sequence similarity of about 92% with a kinase protein from soybean, in the carboxy-terminal region. The kinase identified in soybean, named GmNIK (Glicine max NIK), has 623 amino acid residues, a molecular mass around 68586.10 kDa and showed the ability of interact with NSP using the two-hybrid system. The GmNIK has a kinase domain 309 419 IIHRDVKAANILL 431 , an ATP binding domain LGKGFGNVYKKGVFPDGTLVAVKK 332 , a transmembrane helix, which is probably responsible for the introduction of the protein in the plasmatic 96 membrane, and leucine-rich regions, such as LTNQIVLLQNNNISGPIPSELGKLKLTQLDLSNNFFSGGIPPSLGHL 144 and 167 MTQLNFLDLSYNNLSGPVPRILAKS 192 . Domains found in GmNIK are characteristic of proteins encoded by resistance genes and of membrane receptors involved in developmental programing. The prediction of a topological model of GmNIK based on its modular structure, similar to the protein encoded by the resistance gene Xa21, suggests an intracellular position of the kinase and nucleotide biding domain, while the leucine-rich regions are located in the extracellular environment. The intracellular position of the kinase domain is consistent to the hypothesis of functional interaction between GmNIK and NSP, since NSP is located inside the cell. Additional assays will be carried out in order to confirm whether the NSP viral protein is phosphorylated by NIK in vitro and in vivo. / Tese importada do Alexandria
19

Caracterização de uma proteína secretória de soja e de sua interação com BiP / Characterization of a soybean secretory protein and its interaction with BiP

Matrangolo, Fabiana da Silva Vieira 20 July 1998 (has links)
Submitted by Reginaldo Soares de Freitas (reginaldo.freitas@ufv.br) on 2016-09-01T12:08:27Z No. of bitstreams: 1 texto completo.pdf: 631605 bytes, checksum: 52432c66349cbd1015ae06e8db596889 (MD5) / Made available in DSpace on 2016-09-01T12:08:27Z (GMT). No. of bitstreams: 1 texto completo.pdf: 631605 bytes, checksum: 52432c66349cbd1015ae06e8db596889 (MD5) Previous issue date: 1998-07-20 / Coordenação de Aperfeiçoamento de Pessoal de Nível Superior / Proteínas solúveis e de membrana da rota secretora são inicialmente endereçadas ao retículo endoplasmático (RE) e translocadas através da membrana deste. Em seguida, elas transitam através do Golgi para alcançar os compartimentos subcelulares e o meio extracelular. O RE mantém uma eficiente maquinaria de translocação, dobramento, associação, montagem de oligômeros e controle de qualidade de proteínas secretórias. A proteína BiP ("Binding Protein"), residente no RE, exibe atividade de chaperone molecular e participa ativamente neste processo por meio de interações proteína:proteína. Com o objetivo de identificar substratos potenciais de BiP, anticorpos contra frações microssomais isoladas da semente de soja foram usados para o escrutínio de uma biblioteca de expressão. Um clone de cDNA, denominado pUFVS64, que codifica uma proteína secretória, foi isolado e caracterizado. A proteína, codificada por pUFVS64 e denominada S-64, é sintetizada na semente de soja, em baixos níveis, e possui uma identidade de seqüência de 85% com uma proteína de membrana que se liga à sacarose, denominada SBP ("Sucrose Binding Protein"). Células intactas foram utilizadas para introdução de genes via eletroporação, ou biobalística, com o objetivo de aumentar a síntese da proteína S-64 em suspensões celulares de soja, de forma a aumentar a sensibilidade dos ensaios para determinação de associações entre as proteínas BiP e S-64.A associação entre BiP e S-64 foi avaliada, levando-se em consideração características bioquímicas diferenciadas, associadas com as referidas proteínas. Ensaios de sedimentação por afinidade, com o uso das resinas de ATP-agarose, GTP-agarose e ConA- sepharose, foram conduzidos, utilizando-se extratos de proteína total, de suspensões celulares de soja. Tanto S-64 quanto BiP são co-precipitadas por GTP-agarose, embora BiP não se associe com este nucleotídeo. A capacidade da resina GTP-agarose em sedimentar BiP reflete associação prévia entre BiP e uma proteína que liga GTP. Similarmente, ATP-agarose foi eficiente em co-sedimentar ambas as proteínas, embora apenas BiP se ligue diretamente à ATP. A sedimentação indireta de S-64 pela resina ATP-agarose demonstrou que S-64 estava a uma proteína que liga a ATP. A proteína S-64 é glicosilada e se liga diretamente a ConA-sepharose, enquanto BiP não se associa diretamente com concanavalina-A. Mesmo assim, BiP foi co-sedimentada indiretamente por ConA- sepharose. Coletivamente, estes resultados sugerem que S-64 interage com BiP, constituindo um substrato em potencial para caracterização de associações mediadas pela proteína BiP de plantas. / Newly synthesized secretory and membrane proteins are synthesized on membrane-bound polysomes and co-translationally sequestered in the lumen of the endoplasmic reticulum (ER). These proteins then move to and through the Golgi complex where they are either secreted or sorted to subcelullar compartments. The ER keeps an efficient machinery for translocation, association, assembly of secretory proteins which functions as a quality control system of protein exit from this organelle. The ER-resident protein BiP (Binding Protein) exhibits a molecular chaperone activity and has been described as an important component of the quality control mechanism in the ER which is mediated by protein:protein interaction. In order to identify potential substrates for BiP, antibodies raised against membrane-enriched protein fractions from soybean seeds where used as a probe to screen a expression library. A cDNA clone, named pUFVS64, that encodes a secretory protein was isolated and characterized. The cDNA-encoded protein, designated S-64, is synthesized at low levels in soybean seeds and shares 85% sequence identity with the sucrose binding protein (SBP) which is a membrane-associated protein. In order to increase the sensitivity in the assays for detection of BiP:S-64 associations, the S- 64 cDNA was introduzed in soybean cultured cells by electroporation or a biolistic particle delivery system. The S-64:BiP association was evaluated taking advantage of the differential biochemical properties associated with the proteins. Affinity-precipitation assays, using ATP-agarose, GTP-agarose and ConA- sepharose resins, were performed with total protein extracts from soybean cultured cells. Both S-64 and BiP are co-precipitated by GTP-agarose, although BiP does not bind to GTP. The capacity of GTP-agarose to precipitate BiP reflects previous association between BiP and a GTP-binding protein. Likewise, the ATP-agarose resin co-precipitates efficiently both proteins, although just BiP binds ATP. The indirect precipitation of S-64 by ATP-agarose demonstrated that S-64 interacts with an ATP-binding protein. The S-64 protein is glycosylated and binds directly to ConA-sepharose, while BiP does not. However, the efficiency of BiP precipitation by ConA-sepharose was as high as of S-64 precipitation. Taken together, these results suggest that S-64 interacts with BiP and may be a potential substrate for the characterization of protein interactions mediated by plant BiP. / Não foi localizado o cpf do autor.
20

Analisando a determinação sexual de vertebrados com base em redes de interação entre proteínas

Valente, Guilherme Targino [UNESP] 21 February 2013 (has links) (PDF)
Made available in DSpace on 2014-06-11T19:32:14Z (GMT). No. of bitstreams: 0 Previous issue date: 2013-02-21Bitstream added on 2014-06-13T21:03:46Z : No. of bitstreams: 1 000741895.pdf: 15459081 bytes, checksum: d63bdd273032427c5d062ded87237abe (MD5) / Atualmente os sistemas biológicos vem sendo abordados por diversas áreas de pesquisas, dentre elas a biologia de sistemas. Essa área tem centrado esforços para descrever e compreender as relações entre os componentes bióticos e abióticos desses sistemas, utilizando para isso a teoria de grafos. Uma forma de estudar esses sistemas, é avaliar as interações entre proteínas, que são as interações biomoleculares mais abundantes nas células. Nesse contexto, a presente tese focou no desenvolvimento de um algoritmo computacional capaz de predizer interações entre proteínas de qualquer espécie ou conjunto protéico. Para isso, foram utilizadas técnicas de aprendizado de máquina (sub-área da inteligência artificial) para a construção e aplicação desse preditor, o qual mostrou-se eficaz em predizer interações entre proteínas de mais de 80 espécies diferentes, incluindo interações entre proteínas de parasita e hospedeiro. Esse novo preditor foi aplicado no proteoma de zebrafish (Danio rerio) e humanos (Homo sapiens), gerando assim redes de interações proteicas para ambas as espécies. As interações obtidas foram avaliadas em um contexto geral e o foco das análises foi direcionado para a sub-rede relacionada com as vias de determinação e diferenciação sexual em vertebrados. Os resultados demonstraram uma relativa baixa conservação desses grafos ao longo da evolução dos vertebrados, tanto do ponto de vista global quanto da sub-rede relacionada com a determinação e diferenciação sexual em vertebrados. Além disso, foi possível observar ao menos um hub conservado entre as duas sub-redes, o qual representa um novo alvo a ser avaliado por pesquisas experimentais. Contudo, os dados demonstram que o preditor gerado possui um grande potencial para diversas áreas de estudos e é bastante útil para predição de interações em larga-escala. Além disso, os aspectos evolutivos aqui... / Nowadays the biological systems have been analyzed under several research foci, including the system biology. This area focus to describe and understand the relationship between biotic and abiotic factors using the graph theory. The protein interactions are target interactions to the system biology because they are the most abundant biomolecular interactions within a cell. Thus, this thesis reported the development of a computational algorithm to predict proteinprotein interactions for all species or protein sets. The machine learning technique (sub-area of artificial intelligence) were used to develop and apply this method, giving effective results to predict protein-protein interaction for more than 80 different species, including parasitehost associations. This new predictor was applied to the proteome set of zebrafish (Danio rerio) and humans (Homo sapiens), generating the protein-protein interactions for both species. Evolutionary aspects of the protein interactions were studied in a broad context and the focus was directed to the sub-network involved in the vertebrate sex determination and differentiation. The results reported a low conservation of those graphs across the evolution in a general view or for the sub-network related to the vertebrate sex determination and differentiation. Moreover, it was reported at least one conserved hub between both subnetworks, to be further evaluated by experimental procedures. Anyway, the data showed that the predictor here reported may be very useful for several research areas and it is desirable for large-scale prediction procedures. Furthermore, the evolutionary aspects discussed in this thesis open new perspectives concerning system biology and evolutionary pathways of vertebrate sex determination and differentiation

Page generated in 0.1203 seconds