Photodynamic therapy (PDT) is a non-invasive treatment of cancer with an advantage of having localized photo-activation of the drug at the targeted tumor cells leaving the healthy cells unaffected by the photo-toxicity of the PDT agent. Organic molecules and 4d/5d metal complexes have been extensively studied for their DNA cleavage activity and photo-cytotoxicity in UV and/or visible light. The photoactivity of the current PDT drugs is due to reactive singlet oxygen species. To address the hypoxic nature within neoplasia and to get a realistic scenario to build model and potent PDT agents, attempts have been made in this thesis work to design and synthesize new cobalt and copper complexes having a variety of ancillary ligands and planar phenanthroline bases showing efficient visible light-induced anaerobic plasmid DNA cleavage activity. The disulfide and thiol compounds are known to generate thyil radical in anaerobic medium in presence of some electron donating solvent. To exploit this chemistry of the sulfur anion radical as a reactive species damaging DNA under light irradiation, we have prepared copper(II) complexes of bis(2-hydroxybenzylamino-ethyl)disulfide and D-penicillaminedisulfide and characterized. The complexes are moderate binders to calf thymus DNA and exhibit plasmid DNA cleavage activity in red light. Near-IR light-induced double-strand DNA cleavage activity is observed for the complexes having 3,3' -dithiodipropionic acid and phenanthroline bases. These complexes show lethal double strand breaks in SC DNA responsible for the inhibition in DNA repair mechanism in the cells thus becoming potent candidates as transcription inhibitors. The work has been extended to achieve better visible light-induced plasmid DNA cleavage activity and UV light-induced photocytotoxicity using a more bio-compatible metal ion, viz. cobalt(II) with the same ligand system and enhancement in the photocytotoxicity is observed. To investigate the role of the disulfide ancillary ligands, complexes of salicylideneaminothiophenol bound to the copper(II) are prepared and the complexes show significant plasmid DNA cleavage activity in red light. Finally, ternary cobalt(III) phenanthroline base complexes are prepared to study their DNA cleavage activity in red light and photo-cytotoxicity in UV light. The complexes show efficient plasmid DNA cleavage activity in red light, significant cytotoxicity in UV light, low dark cytotoxicity, and protein (BSA, lysozyme) cleavage activity in UV light. The mechanistic aspects of the photo-induced DNA and protein cleavage activity of the complexes have been studied. A dual involvement of the charge transfer and d-d band is observed in the photosensitization process leading to generation of reactive oxygen species. In summary, the thesis work presents cobalt and copper complexes having thiolate and disulfide moieties that are designed and synthesized as new photodynamic therapeutic agents showing anaerobic DNA cleavage activity in red light and photocytotoxicity. The present study opens up new strategies for designing and developing cobalt and copper based photosensitizers for their potential photochemotherapeutic applications under hypoxic reaction conditions. References: Lahiri, D. et al., J Chern. Sci, 2010, 122, 321-333; Inorg. Chern., 2009, 48, 339-349; Dalton Trans. 2010,39,1807-1816; Polyhedron, 2010, 29, 2417-2425.

Parmi 30 souches, seule 4F44 excrète une activité dans son milieu de culture qui ne résulte pas de la présence de protéases intracellulaires due à une lyse cellulaire.D’après le séquençage N-ter, l’enzyme soluble chez 4F44 est PrtS retrouvée sous deux formes (non mature et mature) à la fois ancrée (60%) et soluble (40%).Sa séquence protéique déduite de prtS est proche de celles de LMD-9 (97% identité), CNRZ385 (98%), JIM8232 (96%) et S. suis (97%) chez qui elle est toujours ancrée. Le domaine d’ancrage contenant LPNTG est conservé chez 4F44, LMD-9, CNRZ385 et S. suis ; ainsi elle serait ancrée au peptidoglycane par la sortase A (SrtA). Chez 4F44, l’absence d’une duplication peptidique imparfaite dans le prodomaine de PrtS pourrait expliquer sa libération partielle, en effet LMD-9 présentant cette duplication possède sa protéase PrtS uniquement sous forme ancrée.La comparaison de la séquence de la sortase déduite du gène de 4F44, ND03, LMD-9, PB18O, PB302 et CNRZ307 a montré que les sites catalytique et actif sont conservés. Seuls 6 résidus d’acides aminés sont différents, la substitution chez 4F44 de I222 par V222 entraînerait sa libération partielle. Les peptides trypsiques C-ter QVTQLPNTGENDTK et QVTQLPNTGENDTKYYLVPGVIIGLGTLLVSIRR ont été identifiés en MS/MS, donc la liaison TG (cible de l’activité peptidasique de SrtA) n’est pas hydrolysée. La caséine β est la caséine préférentiellement hydrolysée. L’enzyme présente une large spécificité de coupure (A, L, M, F, Y, W, V, S, T, N, Q, R, H et K en position P1). Globalement elle libère 33 peptides bioactifs : ECA-inhibiteurs, mitogènes, opioïdes, immunomodulants, antibactériens, antioxydants, antimutagènes / Among 30 strains, only 4F44 strain releases a activity in the medium which does not results from the presence of intracellular protease due to cell lysis. This soluble protease is PrtS in two forms (non mature and mature), 60% as anchored to cell wall and 40% as released in the medium. The protein sequence deduced from the gene is slightly different to those of LMD-9 (97% identity), CNRZ385 (98%), JIM8232 (96%), S. suis (97%). The protein sequence of the anchor domain including LPNTG is conserved as for LMD-9, CNRZ385 and S. suis ; so this PrtS might be anchored to peptidoglycan by sortase A (SrtA).In 4F44, the absence of an imperfect duplication of a peptide sequence at prodomain of PrtS could explain the partial liberation, furthermore, the LMD-9 strain which presents this duplication possess the protease PrtS only the anchored form.Comparison of protein sequence deduced from the srtA gene in 4F44, ND03, LMD-9, PB18O, PB302 and CNRZ307 strains showed that the residues of the catalytic and active sites are conserved. Six amino acids are different for 4F44, I222 replaced by a V222 possibly leads to the partial liberation of PrtS. The trypsic C-ter peptides QVTQLPNTGENDTK and QVTQLPNTGENDTKYYLVPGVIIGLGTLLVSIRR have been identified by MS/MS, indicating that the peptide bond of T and G (target of endopeptidasic activity of Srt A) is not hydrolyzed.β-casein is preferentially degraded in comparison to other caseins. Soluble PrtS has a broad specificity against A, L, M, F, Y, W, V, S, T, N, Q, R, H and K at position P1. Globally, it releases 33 bioactive peptides (antihypertensives, mitogenics, oipoide, immunomodulantors, antimicrobials, antioxydants, antimutagens)

Tato práce se zabývá oblastí dvourozměrných materiálů, jejich přípravou a analýzou. Pravděpodobně nejznámějším zástupcem dvourozměrných materiálů je grafen. Tento 2D allotrop uhlíku, někdy nazývaný „otec 2D materiálů“, v sobě spojuje neobyčejnou kombinaci elektrických, tepelných a mechanických vlastností. Grafen získal mnoho pozornosti a byl také připraven mnoha metodami. Jedna z těchto metod však stále vyniká nad ostatními kvalitou produkovaného grafenu. Mechanická exfoliace je ve srovnání s jinými technikami velmi jednoduchá, takto připravený grafen je však nejkvalitnější. Práce je také zaměřena na optimalizaci procesu tvorby heterostruktur složených z vrstev grafenu a hBN. Dle prezentovaného postupu bylo připraveno několik van der Waalsových heterostruktur, které byly analyzovány Ramanovskou spektroskopií, mikroskopií atomových sil a nízkoenergiovou elektronovou mikroskopií. Měření pohyblivosti nosičů náboje bylo provedeno v GFET uspořádání. Získané hodnoty pohyblivosti prokázaly vynikající transportní vlastnosti exfoliovaného grafenu v porovnání s grafenem připraveným jinými metodami. V práci popsaný proces přípravy je tedy vhodný pro výrobu kvalitních heterostruktur.

The bacterium Chlamydia trachomatis is the leading cause of bacterial sexually transmitted infection worldwide. When left untreated, chlamydial infections can lead to severe complications, such as infertility. Lack in current prevention and management due to its asymptomatic course of infection highlight the need for an effective vaccine against chlamydia. There is no vaccine at present to protect against chlamydia, but research is ongoing. A research group at Örebro University has developed a protein antigen candidate. This project focused on the production of the candidate, here called Protein X, for preclinical trials. This included optimising production in Escherichia coli to maximise formation of soluble protein, optimising purification, buffer exchange and removal of His-tag. It was found that formation of soluble protein was favoured in lower expression temperatures. Furthermore, purification was performed on soluble and insoluble protein fractions using immobilised metal affinity chromatography. However, issues with inefficient binding to the resin and purity could not be solved and further optimisation is needed. Buffers were tested to find a suitable buffer for preclinical experiments, but the protein precipitated in all buffers. It was however found that protein from the insoluble fraction dissolved in pure water. Lastly, removal of the His-tag was performed with a non-enzymatic method that utilises nickel ions instead of expensive proteases. Efficient removal was however not achieved and enzymatic methods may be considered instead. In conclusion, this project highlighted issues in the production of Protein X and may guide the research group towards improving this process for efficient preclinical preparations.

Les cycles azotés font partie intégrante de la vie sur Terre. Cette thématique est transcrite dans les travaux de cette thèse à travers les tétrazoles et les morpholines. Les morpholines sont des azacycles saturés possédant de nombreuses propriétés physico-chimiques et structurales intéressantes, ce qui en fait un motif de choix en chimie médicinale. L'essor des morpholines est d'autant plus important que les industries pharmaceutiques tendent à limiter l'utilisation de cycles insaturés au profit de motifs permettant des structures plus complexes et occupant les trois dimensions de l'espace. Ainsi, le développement de nouvelles voies d'accès aux morpholines est contemporain. La contribution présentée dans ce manuscrit s'appuie sur la réduction de tétrazoles oxabicycliques par des hydrures. Le mécanisme du clivage réductif du tétrazole en amine a par ailleurs été étudié et élucidé. Les cyanamides forment un groupement fonctionnel intéressant grâce à leur nature électronique ambivalente. Elles sont de plus en plus utilisées en chimie médicinale en tant qu'inhibiteurs covalents. Alors que les cyanamides ont été découvertes à l'aube de la chimie organique, leurs synthèses ont traditionnellement eu recours à des sources de cyanure, composé extrêmement toxique. La métallation en position 5 des tétrazoles 1-substitués permet d'induire la rétrocyclisation spontanée conduisant à l'expulsion d'une molécule de diazote et d'un sel de cyanamidure. Ce sel a pu être isolé ou alkylé in situ, offrant une nouvelle voie d'accès aux cyanamides sans source de cyanure. Les cyanamides ainsi obtenues ont pu être diversifiées en amidines par addition d'organolithiens. La Polygonapholine est un alcaloïde contenant une morpholine 2,6-disubstituée isolé en 1997. La structure rapportée est probablement erronée et seule une synthèse en laboratoire peut confirmer son exactitude. Ainsi, la première synthèse totale de ce produit naturel a été débutée et est présentée dans le dernier chapitre de ce manuscrit. / Nitrogen-containing rings are core entities in the living world. This theme is conveyed in the manuscript through tetrazoles and morpholines. Morpholines are saturated azacycles possessing numerous physico-chemical and structural properties, which makes them a motif of interest in medicinal chemistry. The impact of morpholines is even more important as pharmaceutical industries try to avoid overuse of unsaturated rings in favor of saturated motifs that allow for more complex structures in the three dimensions. Therefore, development of new methods to access morpholines is an ongoing activity in many laboratories. The approach presented herein relies on the hydride reduction of oxabicyclic tetrazoles to morpholines. A detailed mechanism of the reductive cleavage of the tetrazole unit is presented. Cyanamides are endowed with an ambident electronic character that adds value to this functional group. They are widely used in drug design as covalent inhibitors. Even though cyanamides were discovered in late 19th century, their synthesis has traditionally relied on the cyanation of amines using toxic cyanide reagents. 1-Substituted 5-metalotetrazoles undergo rapid cycloreversion releasing dinitrogen and forming N-metalated cyanamide salts. The salts can be isolated or alkylated in situ, providing a new method for accessing cyanamides without the use of cyanide reagents. The obtained cyanamides could be subjected to an addition reaction with organolithium reagents, thereby yielding novel amidines. The alkaloid Polygonapholine is a 2,6-disubstituted morpholine isolated in 1997. The reported structure has never been confirmed, nor has the natural product been synthesized in the laboratory. Efforts towards its total synthesis and stereochemical confirmation is presented in the last chapter of the thesis.

The aim of this thesis is to summarize the knowledge gained in the field of grinding medium-hard and hard materials. Work has focused on examining the grindability of the material using available laboratory mill. The part of the work is subsequent optimization of the grinding process on the device and evaluation of the results.

La maturation 3’ des pré-ARNm constitue une étape majeure dans la régulation post-transcriptionnelle de l’expression des gènes, indispensable à la stabilité, l’export vers le cytoplasme et la traduction des ARNm. Elle est composée de deux réactions : un clivage à l’extrémité 3’ suivie de l’addition d’une queue poly(A). Des études ont montré que la maturation en 3’ est inhibée en réponse aux dommages de l’ADN. Cependant, la cellule a mis en place des mécanismes compensatoires qui permettent à certains pré-ARNm d’être correctement maturés assurant ainsi le maintien de son intégrité. Les travaux que nous avons menés ont mis en évidence un mécanisme de résistance à l’inhibition de maturation en 3’ du pré-ARNm codant pour le suppresseur de tumeur p53. Ce mécanisme fait intervenir l’hélicase DHX36 qui déplie une structure secondaire appelée G-quadruplexe située en aval du site de clivage. Par ailleurs dans une deuxième étude, nous avons montré que la maturation en 3’ maintenue du pré-ARNm p53 en réponse aux dommages de l’ADN, est découplée du processus de transcription, contrairement au pré-ARNm TBP dont la maturation 3’ est inhibée en réponse aux dommage de l’ADN. Ce découplage a lieu grâce à un clivage co-transcriptionnelle du pré-ARNm p53 au niveau de la chromatine qui entraîne sa libération dans le nucléoplasme où il subit sa maturation en 3’. Une étude à grande échelle nous a permis de montrer que ce mécanisme de maturation en 3’ survenant dans le nucléoplasme est associé au maintien d'une maturation en 3’ efficace en réponse aux dommages de l’ADN. / The 3’-end processing of pre-mRNA, a key step in the post-transcriptional gene expression regulation, is essential for mRNA stability, export and translation. This process is a two-step reaction composed of a cleavage at the 3’-end followed by the addition of a poly(A) tail. Studies have shown that pre-mRNA 3’-end processing is inhibited in response to DNA damage. However, compensatory mechanisms exist to allow some pre-mRNA to be properly processed at their 3’-end in order to maintain cell integrity. For instance, in response to DNA damage, the 3’-end processing of the pre-mRNA coding for the tumor suppressor p53 is able to escape from its inhibition. In the present work, we have shown that the underlying mechanism involves the DHX36 helicase that unwinds a secondary structure called G-quadruplex located downstream of the cleavage site of the p53 pre-mRNA. Moreover, in a second study, we have shown that the maintained p53 pre-mRNA 3’-end processing in response to DNA damage is uncoupled from the transcription process, unlike the inhibited TBP pre-mRNA 3’-end processing. This uncoupling takes place through a co-transcriptional cleavage of p53 pre-mRNA from the chromatin and its release in the nucleoplasm where it undergoes its 3’-end processing. A genome-wide study allowed us to show that the pre-mRNA 3’-end processing occurring in the nucleoplasm is associated with a maintained 3’end processing in response to DNA damage

No description available.

Les septines sont des protéines conservées de la levure à l’homme qui sont impliquées dans divers processus cellulaires tels que la cytokinèse, le transport vésiculaire et l’organisation du cortex cellulaire. Il existe 13 gènes de septines retrouvés en plusieurs isoformes chez l’humain, et seulement cinq chez Drosophila melanogaster, Sep1, Sep2, Pnut, Sep4 et Sep5, ce qui en fait un modèle idéal vu son génome simple. Les septines sont composées d’un domaine de liaison au GTP très conservé entre les espèces, dont le rôle reste à ce jour ambiguë, ainsi que de régions N et C-terminales variables. Les septines s’assemblent entre elles pour former un hexamère, composé de Sep1, Sep2 et Pnut chez Drosophila melanogaster, via l’interface N-C et G des septines. Ces hexamères s’assemblent bout à bout afin de former les filaments de septines. Ces filaments peuvent ensuite se regrouper et s’assembler en structures hautement ordonnées telles que des anneaux, des tubes, des faisceaux de filaments, des cages et elles sont retrouvées au sillon de clivage durant la cytokinèse. Le but était de déchiffrer les mécanismes d’assemblage des filaments de septines qui mènent à la formation des différentes structures, afin de mieux comprendre les mécanismes d’interaction entre les septines. Au sein des cellules S2 de Drosophila melanogaster, les septines sont retrouvées à trois structures hautement ordonnées et dépendantes de Pnut endogène : des tubes cytoplasmiques, des anneaux cytoplasmiques et le sillon de clivage durant la cytokinèse. Notre hypothèse est qu’il existe plusieurs mécanismes qui régissent la formation des structures hautement ordonnées et que ceux-ci sont dépendants des régions N et C terminales variables des septines qui sont impliquées dans plusieurs interactions. Divers mutants de Sep1, Sep2 et Pnut tronqués en N et en C-terminal ont été fusionnés à une protéine fluorescente et caractérisés par microscopie confocale. La localisation de ces mutants a été répertoriée et analysée en présence des septines endogènes ou lors de la déplétion de celles-ci. Nos résultats suggèrent que le domaine de liaison au GTP est suffisant pour le recrutement des septines au sillon de clivage durant la cytokinèse, mais que la région N-terminale est requise la formation des tubes et des anneaux cytoplasmiques dépendants de Pnut. / Septins are conserved from yeast to humans and are implicated in diverse cellular processes such as cytokinesis, vesicular transport and cellular cortical organization. There are 13 known genes that encode for human septins, which also have many isoforms, while there are only five septin genes in Drosophila melanogaster: Sep1, Sep2, Pnut, Sep4 and Sep5, which makes it an ideal model system. Septins have a conserved GTP binding domain, whose role is still not fully understood, and variable N-C-termini. Septins assemble together, via N-C and G interfaces, to form a hexamer, that is composed of Sep1, Sep2 and Pnut in Drosophila melanogaster, which assemble end-to-end to form non polar filaments. These filaments can subsequently assemble together to form higher-ordered structures, such as rings, tubes, bundles, and gauzes. Furthermore, septins are recruited to the cleavage furrow during cytokinesis although their organization there is unclear. The aim of this project is to define septin assembly mechanisms that can lead to the formation of different higher ordered structures. In Drosophila melanogaster S2 cells, septins are recruited to three, readily observable septin dependent structures: cytoplasmic rings, cytoplasmic tubes, and the cleavage furrow during cytokinesis. Our hypothesis is that multiple mechanisms govern septin incorporation into these structures and that these mechanisms differentially depend on septin N-C variable termini. A panel of mutants of Sep1, Sep2 and Pnut truncated in N-C-termini were fused to fluorescent proteins and their localization in S2 cells monitored by confocal microscopy, with or without depletion of endogenous septins. My results suggest that the GTP binding domain is sufficient for septin recruitment to the cleavage furrow during cytokinesis, but that the septin N-termini are required for recruitment to the cytoplasmic tubes and rings.

De nos jours, la moitié des infections nosocomiales sont liées à la pose de dispositifs médicaux. Dans ce contexte, nous avons développé deux types de revêtements antimicrobiens adaptés au domaine biomédical. Le premier s'appuie sur le greffage d’un peptide comprenant une séquence d’accroche, une séquence antimicrobienne et un site de clivage spécifique d'un pathogène. La séquence antimicrobienne sera alors libérée uniquement en présence du pathogène. Malgré la réussite de l’accroche du peptide, certains paramètres restent encore à optimiser afin d’obtenir un effet antimicrobien. Le deuxième revêtement s’appuie sur la conception d’un film antimicrobien « couche-par-couche » avec l’utilisation de poly(L-arginine) (PAR) et d’acide hyaluronique (HA). L’influence de la taille des chaînes de PAR a été étudiée et seul le film construit à partir de PAR de 30 résidus possède un effet antibactérien. Avec cette PAR, nous avons démontré que HA est le seul polyanion conduisant à des propriétés antibactériennes. Ces propriétés antimicrobiennes sont maintenues lorsque d’autres homopolypeptides cationiques sont associés à HA. / Nowadays, about half of hospital-acquired infections are due to medical devices implantation. In this context, we have developed two types of antimicrobial coatings adapted to the biomedical field. The first one is based on peptide composed of an anchoring sequence, an antimicrobial sequence and a pathogen-specific cleavage site and grafted on the substrate. The antimicrobial site will be released only in the presence of the pathogen through the use of the cleavage site. Despite of the success of peptide grafting, some parameters must be optimized in order to obtain an antimicrobial effect. The second antimicrobial coating concept is based on the layer-by-layer technique by using poly(L-arginine) (PAR) and hyaluronic acid (HA). The effect of the size of PAR chains on the antimicrobial character of the coating was investigated and it is proven that only films composed with PAR of 30 residues present an antibacterial effect. Moreover HA is the only polyanion leading to such antimicrobial multilayer. It is also demonstrated that this antimicrobial properties is maintained when other cationic homopolypeptides are used in association with HA in layer-by-layer films.