Les symbioses bactérie-légumineuse (nodulation) et champignon-plante (mycorhization) présentent un intérêt agrobiologique et écologique majeur ; elles permettent aux plantes de croître naturellement sur un sol aride et peu fertile. Il a été démontré très récemment que les signaux impliqués dans la mise en place de la symbiose endomycorhizienne à arbuscule (facteurs "Myc") sont très proches de ceux de la nodulation. Il s'agit de molécules appartenant à la famille des lipo-chitooligosaccharides. Afin de réaliser la synthèse de ces molécules, deux nouvelles méthodologies ont été développées. L'ouverture oxydante d'acétals de 4,6-O-benzylidène de plusieurs glycopyranosides (en série gluco, galacto et manno) par le diméthyldioxirane (DMDO) a été étudiée. Le contrôle de la régiosélectivité a été effectué grâce au groupement protecteur introduit sur la fonction alcool de la position 3. La formation directe de β-glycosides de la N-acétyl-D-glucosamine par catalyse au triflate de fer (III) a été étudiée. La réaction a été menée sous irradiation micro-ondes ou en flux continu (système minifluidique Vapourtec®). Une nouvelle stratégie pour la synthèse du facteur [Myc-IV (C16:0, S)] a ensuite été établie. Nous avons utilisé un réactif peu toxique et non odorant pour introduire le motif thio nécessaire à la formation de deux liaisons glycosidiques. Le disaccharide précurseur de l'unité réductrice a été obtenu grâce à la première méthodologie développée au cours de cette thèse.

Notre travail de thèse a été dédié à la synthèse et à la caractérisation bio-physicochimique de complexes osmium nitrosyle, qui pourraient relarguer l'oxyde nitrique (NO) au sein des cellules tumorales pour conjuguer les propriétés anticancéreuses souvent associés aux complexes du groupe du platine avec la toxicité de l'oxyde nitrique. Le premier chapitre de notre mémoire de thèse présente l'état de l'art dans le domaine des composés anticancéreux et le rôle de l'oxyde nitrique dans l'apoptose cellulaire. Le deuxième chapitre concerne la synthèse et la caractérisation de complexes d'azole (C)[Os(NO)Cl4(A)] (C = Bu4N+, Na+, HA+; A = indazole, pyrazole, benzimidazole, imidazole), où le plus cytotoxique est H2ind[cis-Os(NO)Cl4(indazole)]. Le troisième chapitre est consacré à l'étude cinétique et thermodynamique par RMN de l'isomérisation trans ↔ cis du complexe (Bu4N)[Os(NO)Cl4(indazole)] qui met en évidence un processus d'isomérisation de type dissociatif. Le quatrième chapitre concerne la synthèse et la caractérisation de complexes d'aminoacides (Bu4N)[Os(NO)Cl4(L)] (L = gly, picolinate, L-, D-pro) qui ont une très faible activité antiproliférative. Le dernier chapitre est consacré à la synthèse et à la caractérisation de clusters hétérométalliques [{Os(NO)Cl3(Ox)}4Ln] (Ln = Gd, Tb, Dy, Y ; Ox=oxalate) dans lesquels la coordinance 8 ou 9 du lanthanide dépend de son rayon ionique. Le précurseur {Os(NO)Cl3(Ox)} a l'activité antiproliférative la plus élevée de tous les complexes osmium nitrosyle connus

Lorsque les verres bioactifs entrent en contact avec des tissus vivants, une série de réactions physico-chimiques (dissolution, précipitation...) ont lieu à l’interface matériau / os, et conduisent à la formation d’une couche phosphocalcique, dont la composition est proche de la phase minérale de l’os (hydroxyapatite). La couche d’apatite sert de site de minéralisation pour les cellules osseuses, ce qui permet in fine un lien intime entre le verre bioactif et les tissus osseux. Ce lien est caractéristique de la bioactivité, qui peut être modulée via plusieurs paramètres du verre comme la composition en éléments majeurs et traces ou les propriétés texturales (surface spécifique, porosité).Dans ce contexte, nous avons élaboré des verres bioactifs dans des systèmes binaires (SiO2-CaO) et ternaires (SiO2-CaO-P2O5). Ces verres ont été dopés en ions zinc et magnésium via la voie sol-gel. Grâce à l'emploi de tensioactifs, nous avons obtenu des verres mésostructurés. Enfin, en utilisant des méthodes dites « d’opale inverse », des verres à macroporosité organisée ont été synthétisés. L'influence de ces paramètres sur la réactivité des verres au contact d’un milieu biologique (DMEM) a principalement été étudiée par des techniques utilisant des microfaisceaux d'ions. L'émission X induite par particules chargées (PIXE) combinée à la spectrométrie de rétrodiffusion Rutherford (RBS) a en effet démontré des effets évidents sur la cinétique, l'amplitude et la distribution spatiale des réactions physico-chimiques. / When bioactive glasses are in contact with living tissues, several physico-chemical reactions (dissolution, precipitation…) take place at the material / bone interface, and lead to the formation of a phosphocalcic layer, whose composition is close to the mineral phase of the bone (hydroxyapatite). The apatite layer is used as a mineralization site for bone cells and finally allows an intimate bond between the bioactive glass and osseous tissues. This bond is typical of bioactivity, which can be modulated through several parameters of the glass, like composition in major and trace elements or textural properties (specific surface, porosity).In this context, we elaborated bioactive glasses in binary (SiO2-CaO) and ternary (SiO2-CaO-P2O5) systems. Glasses have been doped with zinc and magnesium ions through the sol-gel route. Thanks to the use of surfactants, we obtained mesostructured glasses. Finally, by using inverse opal method, organized macroporous glasses have been synthesized. The influence of these parameters on the reactivity of glasses in contact with a biological medium (DMEM) has been mainly studied by techniques using micro-ion beams. The X-ray emission induced by charged particles (PIXE) combined with Rutherford backscattering spectrometry (RBS) has indeed demonstrated clear effects on the kinetics, the amplitude, and the spatial distribution of the physico-chemical reactions.

Les propriétés exceptionnelles des composés fluorés ont entrainées un développement considérable de la chimie du fluor depuis les années 1950. Aujourd'hui les substances fluorées se retrouvent dans la plupart des domaines tels que la chimie thérapeutique ou l'agrochimie. L'atome d'azote étant ubiquitaire en chimie médicinale, le développement de voies synthétiques permettant l'obtention de fluoroamines est donc essentiel.Au laboratoire, une étude a précédemment été menée sur la réaction de bromofluoration de composés azotés insaturés en milieu superacide de type HF/SbF5. Le NBS utilisé comme donneur d'ion broménium, après activation par polyprotonation, a permis d'accéder à des composés azotés bromofluorés difficiles à obtenir en milieux classiques. Cependant l'ion bromonium s'isomérise rapidement conduisant aux produits difluorés. Les ions chloroniums ayant une réactivité différente de celle des ions bromoniums, ce travail porte sur l'étude des ions chloroniums dans des systèmes dicationiques générés en milieu superacide.Dans un premier temps l'impact des paramètres expérimentaux a été étudié par analyse des produits de réaction et par des expériences de RMN in situ. L'étude a ensuite été étendue à un panel de substrats afin de mesurer l'impact de la structure du substrat sur la réaction de chlorofluoration. Enfin l'effet de substituants halogènes sur la double liaison carbone-carbone a été étudié. Ces travaux ont permis de mettre en lumière le mécanisme réactionnel impliqué dans cette réaction, puis d'appliquer la méthode pour la préparation de composés biologiquement actifs. / Exceptional properties of fluorinated compounds led to a considerable development of fluorine chemistry since the 1950's. Nowadays, fluorinated products have a key role in many domains going from medicinal chemistry to agricultural chemistry. As nitrogen atom is ubiquitous in pharmaceuticals, the development of new synthetic ways for the preparation of fluorinated nitrogen containing compound is of relevant interest.Previously, the superacid team developed a bromofluorination reaction of unsaturated nitrogen containing compounds in superacidic media HF/SbF5. The reaction was performed by using the NBS as halenium ion donor, activated through polyprotonation, permitting the access to bromofluorinated nitrogen containing compounds difficult to be obtained under classical organic conditions. Nevertheless the resulting bromonium ion isomerizes quickly to produce difluorinated products. Chloronium ions show different reactivities than the bromonium ones; so this study is focused on the reactivity of chloronium ion in dicationic systems generated by the use of superacidic media.The first step of the study was focused on the evaluation of the impact of experimental conditions by reaction products analysis and in situ NMR experiments. Then the influence of substrate structure on the reaction course was investigated. Finally the halosubstitution on the carbon-carbon double bound was studied. This work allowed us to highlight the chlorofluorination reaction mechanism and then to extend this method to bioactive compounds synthesis.

Ce travail de thèse concerne l'évaluation biologique et physico-chimique de deux biomatériaux : verre pure associé au risedronate (46S6-xRIS) et une vitrocéramique poreuse dopée avec l'oxyde de zinc et le nitrure de titane noté 46S6-10Zn-2Ti. Le premier est un matériau hybride composé du verre (46S6) et d'un bisphosphonate le risedronate à différentes teneurs (xRIS) avec x= 8, 12 et 20%. Le deuxième est une vitrocéramique ayant une porosité créée par l'élimination de N après calcination. Les analyses physico-chimiques après les tests in vitro du 46S6-xRIS montrent une modification de la cinétique de la bioactivité de ces composites selon la quantité de risedronate ajoutée au 46S6. Les analyses in vivo ont été aussi menées sur le 46S6-10Zn-2Ti. Cette vitrocéramique a été implantée dans des condyles fémoraux de rattes ostéoporotiques, phénomène créé par l'irradiation des rattes à différentes doses de rayons γ. L'investigation biologique après irradiation montre un déséquilibre entre la peroxydation lipidique et les enzymes antioxydants. L'implantation en site osseux avec le 46S6-10Zn-2Ti a permis la restauration de cette balance. L'étude histologique montre le rétablissement du tissu osseux. Cependant, celui ci décroit avec l'augmentation de la dose des rayons gamma. Pour l'exploration physico-chimique, plusieurs techniques complémentaires ont été utilisées pour évaluer la cinétique d'ossification. La bioconsolidation de notre vitrocéramique a été également évaluée après implantation chez des lapins. Le microscanner (mCT) montre la résorption du 46S6-10Zn-2Ti et l'osséo-intégration des cellules osseuses dans les pores du bio-implant alors que, l'étude histologique montre que le 46S6-10Zn-2Ti est presque totalement dégradé et remplacé par le tissue osseux. Le MEB met en évidence la dégradation du 46S6-10Zn-2Ti et son remplacement par un dépôt apatitique. Les spectres MAS-RMN du ³¹P et u ²⁹Si illustrent la dégradation progressive du 46S6-10Zn-2Ti en faveur du développement de l'apatite biologique. / This work focuses on the biological and physicochemical evaluations of two biomaterials: a bioactive glass associated to risedronate (46S6-xRIS) and a porous glass ceramic doped with zinc oxide and titanium nitride noted 46S6-10Zn-2Ti. The first is a hybrid material composed of bioactive glass (46S6) and a bisphosphonate, the risedronate with different contents (xRIS) with x=8, 12 and 20%. The second is a ceramic glass having a porosity, which has been created following the elimination of N after heating. Physicochemical analysis after the in vitro essays of 46S6-xRIS show the modification of the bioactivity kinetic of these composites proportional to the quantity of risedronate added to the 46S6. The in vivo analyses were also conducted in the 46S6-10Zn-2Ti. This glass ceramic was implanted in the femoral condyles of osteoporotic rats. This phenomenon was created after its irradiation at different doses of γ-rays. The biological investigations after irradiation show an imbalance between the lipid peroxidation and antioxidants enzymes. The implantation of 46S6-10Zn-2Ti in bone tissue restored the oxidative balance. The histological study manifests the restoration of bone tissue. However, this restoration decreased with the rising of γ-rays doses. For the physiochemical exploration, several complementary techniques were used to evaluate the kinetic of ossification. The porous glass ceramic was evaluated also in the bioconsolidation process after implantation in rabbit. The X-ray Micro-Computer Tomography (mCT) shows the resorption of the 46S6-10Zn-2Ti and the osseointegration of bones cells in the biomaterial pores. Moreover, the histological study illustrates that the degradation and the resoption of the 46S6-10Zn-2Ti is almost total. The SEM highlights the degradation of the 46S6-10Zn-2Ti and its replacement by an apatitic deposit. The MAS-NMR spectra of ³¹P and of ²⁹Si illustrate a progressive degradation of 46S6-10Zn-2Ti in favor of the development of a biological apatite.

Parmi 30 souches, seule 4F44 excrète une activité dans son milieu de culture qui ne résulte pas de la présence de protéases intracellulaires due à une lyse cellulaire.D’après le séquençage N-ter, l’enzyme soluble chez 4F44 est PrtS retrouvée sous deux formes (non mature et mature) à la fois ancrée (60%) et soluble (40%).Sa séquence protéique déduite de prtS est proche de celles de LMD-9 (97% identité), CNRZ385 (98%), JIM8232 (96%) et S. suis (97%) chez qui elle est toujours ancrée. Le domaine d’ancrage contenant LPNTG est conservé chez 4F44, LMD-9, CNRZ385 et S. suis ; ainsi elle serait ancrée au peptidoglycane par la sortase A (SrtA). Chez 4F44, l’absence d’une duplication peptidique imparfaite dans le prodomaine de PrtS pourrait expliquer sa libération partielle, en effet LMD-9 présentant cette duplication possède sa protéase PrtS uniquement sous forme ancrée.La comparaison de la séquence de la sortase déduite du gène de 4F44, ND03, LMD-9, PB18O, PB302 et CNRZ307 a montré que les sites catalytique et actif sont conservés. Seuls 6 résidus d’acides aminés sont différents, la substitution chez 4F44 de I222 par V222 entraînerait sa libération partielle. Les peptides trypsiques C-ter QVTQLPNTGENDTK et QVTQLPNTGENDTKYYLVPGVIIGLGTLLVSIRR ont été identifiés en MS/MS, donc la liaison TG (cible de l’activité peptidasique de SrtA) n’est pas hydrolysée. La caséine β est la caséine préférentiellement hydrolysée. L’enzyme présente une large spécificité de coupure (A, L, M, F, Y, W, V, S, T, N, Q, R, H et K en position P1). Globalement elle libère 33 peptides bioactifs : ECA-inhibiteurs, mitogènes, opioïdes, immunomodulants, antibactériens, antioxydants, antimutagènes / Among 30 strains, only 4F44 strain releases a activity in the medium which does not results from the presence of intracellular protease due to cell lysis. This soluble protease is PrtS in two forms (non mature and mature), 60% as anchored to cell wall and 40% as released in the medium. The protein sequence deduced from the gene is slightly different to those of LMD-9 (97% identity), CNRZ385 (98%), JIM8232 (96%), S. suis (97%). The protein sequence of the anchor domain including LPNTG is conserved as for LMD-9, CNRZ385 and S. suis ; so this PrtS might be anchored to peptidoglycan by sortase A (SrtA).In 4F44, the absence of an imperfect duplication of a peptide sequence at prodomain of PrtS could explain the partial liberation, furthermore, the LMD-9 strain which presents this duplication possess the protease PrtS only the anchored form.Comparison of protein sequence deduced from the srtA gene in 4F44, ND03, LMD-9, PB18O, PB302 and CNRZ307 strains showed that the residues of the catalytic and active sites are conserved. Six amino acids are different for 4F44, I222 replaced by a V222 possibly leads to the partial liberation of PrtS. The trypsic C-ter peptides QVTQLPNTGENDTK and QVTQLPNTGENDTKYYLVPGVIIGLGTLLVSIRR have been identified by MS/MS, indicating that the peptide bond of T and G (target of endopeptidasic activity of Srt A) is not hydrolyzed.β-casein is preferentially degraded in comparison to other caseins. Soluble PrtS has a broad specificity against A, L, M, F, Y, W, V, S, T, N, Q, R, H and K at position P1. Globally, it releases 33 bioactive peptides (antihypertensives, mitogenics, oipoide, immunomodulantors, antimicrobials, antioxydants, antimutagens)

Les protéines du lait bovin sont la source la plus importante en peptides bioactifs qui permettraient de maintenir le capital-Santé du consommateur. Nous nous sommes intéressés aux peptides inhibiteurs de l'enzyme de conversion de l'angiotensine I (ECA) et aux caséinophosphopeptides (CPP) chélateurs de minéraux pour étudier in vitro leur mécanisme d'interaction avec leurs cibles moléculaires. En effet, les peptides d'origine alimentaire, inhibiteurs de l'ECA (IEC) contribueraient à une prévention de l'hypertension. Pour comprendre la relation entre la séquence de ces peptides et leur pouvoir IEC, les paramètres d'inhibition de l'ECA somatique de poumon de lapin, qui possède 2 domaines N et C ayant chacun un site actif, par des peptides (FALPQYLK, FALPQY, ALPMHIR, IPP et VPP) issus de protéines du lait et des peptides dérivés ont été étudiés. De plus, l'interaction entre certains de ces peptides avec l'ECA somatique humaine a été caractérisée par la technologie Biacore®. La cartographie des sites de liaison de FALPQY en compétition avec le captopril (inhibiteur compétitif des 2 sites actifs de l'ECA) et le peptide BPP-11b (inhibiteur sélectif du domaine C de l'ECA) montre que ce peptide se fixe au niveau des 2 sites actifs de l'ECA. Par ailleurs, les CPP sont un bon moyen de corriger les carences minérales car ils sont capables de former des complexes solubles avec les cations, améliorant ainsi leur biodisponibilité. L'interaction entre le CPP [bêta]-CN (f1-25)4P et Ca2+, Mg2+, Zn2+ et Cu2+ a été étudiée par microcalorimétrie de titration isotherme : 1 mole de CPP fixe 2 moles de Ca2+, de Mg2+ ou de Zn2+ à pH 8, avec des constantes d'affinité faibles, mais ne fixe pas Cu2+ / Bovine milk proteins are the most important source of bioactive peptides. These peptides may contribute to maintain optimal health state. In the current study, we attempted to elucidate in vitro the molecular interaction mode between both angiotensin I-Converting enzyme (ACE) inhibitory peptides and mineral-Chelating caseinophosphopeptides (CPP). Indeed, ACE inhibitory peptides from food may provide a natural and safe alternative to prevent hypertension. In order to better understand the relationship between the sequence of ACE inhibitory peptides and their inhibitory potency, the inhibition parameters of rabbit lung somatic ACE (that possesses 2 domains, N and C, which are both catalytically active) by bovine milk peptides (FALPQYLK, FALPQY, ALPMHIR, IPP, and VPP) and other peptides with related sequence were investigated. Moreover, the interaction between some peptides and their derivatives with human somatic ACE was analyzed by Biacore® technology. The mapping of FALPQY-ACE interaction sites in competition with captopril (a competitive inhibitor for both sites) and also with BPP-11b (a selective inhibitor of the C-Domain active site) showed that FALPQY binds at or near the two active sites located on the 2 domains of ACE. In addition, CPP efficiently bind cations of nutritional interest by forming soluble complexes which prevent the precipitation of minerals at alkaline pH and increasing thus their bioavailability. The interaction between [beta]-CN (f1-25)4P, and Ca2+, Mg2+, Zn2+, and Cu2+ cations, was characterized by isothermal titration calorimetry: 1 mole of [beta]-CN (f1-25)4P binds 2 moles of Ca2+, Mg2+, and Zn2+ at a pH 8, with a low affinity, but does not bind Cu2+ cation

Notre travail de thèse a été dédié à la synthèse et à la caractérisation bio-physicochimique de complexes osmium nitrosyle, qui pourraient relarguer l’oxyde nitrique (NO) au sein des cellules tumorales pour conjuguer les propriétés anticancéreuses souvent associés aux complexes du groupe du platine avec la toxicité de l’oxyde nitrique. Le premier chapitre de notre mémoire de thèse présente l’état de l’art dans le domaine des composés anticancéreux et le rôle de l’oxyde nitrique dans l’apoptose cellulaire. Le deuxième chapitre concerne la synthèse et la caractérisation de complexes d’azole (C)[Os(NO)Cl4(A)] (C = Bu4N+, Na+, HA+; A = indazole, pyrazole, benzimidazole, imidazole), où le plus cytotoxique est H2ind[cis-Os(NO)Cl4(indazole)]. Le troisième chapitre est consacré à l’étude cinétique et thermodynamique par RMN de l’isomérisation trans ↔ cis du complexe (Bu4N)[Os(NO)Cl4(indazole)] qui met en évidence un processus d’isomérisation de type dissociatif. Le quatrième chapitre concerne la synthèse et la caractérisation de complexes d’aminoacides (Bu4N)[Os(NO)Cl4(L)] (L = gly, picolinate, L-, D-pro) qui ont une très faible activité antiproliférative. Le dernier chapitre est consacré à la synthèse et à la caractérisation de clusters hétérométalliques [{Os(NO)Cl3(Ox)}4Ln] (Ln = Gd, Tb, Dy, Y ; Ox=oxalate) dans lesquels la coordinance 8 ou 9 du lanthanide dépend de son rayon ionique. Le précurseur {Os(NO)Cl3(Ox)} a l’activité antiproliférative la plus élevée de tous les complexes osmium nitrosyle connus / The PhD thesis was dedicated to the synthesis and bio-physic-chemical characterization of osmium nitrosyl complexes which could release nitric oxide (NO) in tumor cells to combine the anticancer properties of the platinum group complexes and the nitric oxide cytotoxicity. The first chapter presents the state of the art in the field of anticancer compounds and the role of nitric oxide in the apoptosis. The second chapter concerns the synthesis and characterization of azole complexes with the general formulae (C)[Os(NO)Cl4(A)] (C = Bu4N+, Na+, HA+; A = indazole, pyrazole, benzimidazole, imidazole), where the most cytotoxic is H2ind[cis-Os(NO)Cl4(indazole)]. The third chapter focuses on the kinetic and thermodynamic study of the trans ↔ cis isomerisation of (Bu4N)[Os(NO)Cl4(indazole)] complex by NMR, which highlights a dissociative isomerisation process. The fourth chapter concerns the synthesis and the characterization of amino acids complexes with the general formulae (Bu4N)[Os(NO)Cl4(L)] (L = gly, picolinate, L-, D-pro) of whose antiproliferative activity is very low. The last chapter is dedicated to the synthesis and characterization of heterometallic clusters with the general formulae [{Os(NO)Cl3(Ox)}4Ln] (Ln = Gd, Tb, Dy, Y ; Ox = oxalate), where the coordination number 8 or 9 depends on its ionic radius. The precursor {Os(NO)Cl3(Ox)} has the highest antiproliferative activity among of all osmium nitrosyl known so far

La biocontamination des surfaces et les risques associés sont des enjeux majeurs économiques et de santé publique. Afin de limiter ou empêcher l’adhésion bactérienne, une des solutions possible consiste en la modification des propriétés des surfaces, afin de leur conférer les fonctions voulues. Dans ce contexte, l’objectif de cette étude est de modifier des surfaces de types métallique (acier) ou polymère : poly(téréphtalate d’éthylène) par des glycomonomères ou des monomères bioactifs. La stratégie de modification des surfaces s’effectue en plusieurs étapes.La première étape permet d’incorporer des fonctions réactives sur les surfaces par traitement acide puis réaction avec la dopamine, ou par traitement plasma ammoniaque. Des fonctions hydroxyle et amine sont introduites. Par la suite un amorceur de polymérisation par transfert d’atome est greffé sur les surfaces. Les monomères sont synthétisés et leur polymérisation étudiée en solution, dans un premier temps dans les conditions de polymérisation radicalaire classique, puis par polymérisation par transfert d’atome. Les conditions optimales sont déterminées, puis les polymérisations sur surfaces effectuées. La dernière étape concerne l’étude des propriétés microbiologiques des surfaces synthétisées.Les glycopolymères protégés et déprotégés de galactose ainsi que les polymères de méthacrylate de gaïacyle et de méthacrylate de thymyle ont été synthétisés. Les monomères ont été polymérisés par polymérisation par transfert d’atome à partir de la surface, sur les surfaces d’acier et de poly(téréphtalate d’éthylène). Après chaque étape de modification de surface, les matériaux ont été systématiquement caractérisés par goniométrie et spectroscopie à photoélectrons X. Les surfaces d’acier fonctionnalisées par le glycopolymère présentent des propriétés anti-adhésives vis-à-vis de Bacillus subtilis, un effet plus marqué est observé après greffage du glycopolymère déprotégé. Les surfaces de poly(téréphtalate d’éthylène) quant à elles, possèdent des propriétés anti-adhésives leur du greffage du poly(méthacrylate de thymyle) vis-à-vis de Listeria monocytogenes, Staphilococcus aureus et Pseudomonas aeruginosa. Un effet anti-biofilm a également été mis en évidence vis-à-vis de Staphilococcus aureus.En parallèle des homopolymères d’ammonium quaternaire et des copolymères obtenus en incorporant les monomères bioactifs ont été synthétisés. Les propriétés antibactériennes sont testées en milieu planctonique vis-à-vis de Bacillus subtilis. Un degré de polymérisation égal à 78 et les groupements halogénoalcane : iodométhane ou bromoéthane permettent l’obtention de la concentration minimale inhibitrice la plus faible. La présence des monomères bioactifs permettent la diminution de la concentration minimale inhibitrice. Le résultat le plus intéressant est obtenu lors de l’incorporation d’un pourcent de N-(4-hydroxy-3-méthoxy-benzyl)-acrylamide. / Bio-contamination of surfaces and related risks are very important economically and for public health. To prevent this phenomenon, one solution is to modify the properties of the surfaces, in order to give them the wanted functionalities. The goal of this study is the modification of metallic surfaces (steel) or polymer surfaces: poly(ethylene terephtalate) with glycomonomers or bioactives monomers. To reach this objective, a multi-step strategy is applied.The first step enabled the incorporation of reactive species on the surfaces by an acid treatment followed by a reaction with dopamine, or by ammonia plasma treatment. Hydroxyl or amine functional groups are added. Then, an initiator of atom transfer radical polymerization is grafted on surfaces. Monomers are synthesized and conventional polymerization and atom transfer radical polymerization are studied. Optimal conditions are determined and polymerization on surfaces achieved. The last step is the study of the microbiological properties of the synthesized surfaces.Protected and unprotected galactose glycopolymers as well as gaiacyl methacrylate and thymyl methacrylate have been synthesized. Monomers have been polymerized by atom transfer radical polymerization directly to the steel or poly(ethylene therephtalate) surfaces. After each step, materials are analyzed by contact angle measurements and X-ray photoelectron spectrometry.Steel surfaces which are functionalized by a glycopolymer and tested in presence of Bacillus subtilis are found to have antiadhesive properties. A most important effect is observed with the unprotected glycopolymer. Poly(ethylene terephtalate) surfaces have antiadhesive properties in presence of Listeria monocytogenes, Staphilococcus aureus and Pseudomonas aeruginosa when poly(thymyl methacrylate) is grafted. An antibiofilm effect is observed with Staphilococcus aureus.Simultaneously, quaternary ammonium homopolymers and copolymers by integration of bioactive monomers have been obtained. Their antibacterial properties are tested in planctonik conditions in presence of Bacillus subtilis. A degree of polymerization equal to 78 and alkyl halide groups: iodomethane and bromoethane enabled to obtain the lowest minimal inhibitory concentration. Bioactive monomers contributed to emphasize this decrease. The most decreasing effect is obtained when one per cent of N-(4-hydroxy-3-méthoxy-benzyl)-acrylamide is integrated.

This thesis concerns the development of a new series of Sr-doped phosphate-based glasses for biomedical applications. Such glasses in powder form are envisaged to have applications in novel composite restorations where the following is achievable: dentin cell-mediated bioremineralization, dental pulp regeneration and as carrier for therapeutics or antibacterial ions.The initial aim was to produce soluble porous phosphate glasses using the sol-gel method (phosphate-alkoxide based sol-gel process). Knowing the effect that the variation of Ca content has on the dissolution properties of the glass, a series of glasses where Ca was progressively increased at the expense of Na was produced. The structure of the prepared samples was probed by XRD, XRF and FTIR to confirm the successful synthesis of the target phosphate-based glass compositions. After that a promising methodology was established, attempts were made to replace Ca with Sr. Different Sr sources were used without success due to the difficulty to fully dissolve those precursors in the sol-gel mixture. Subsequently, the issue of the toxicity of some precursors and solvents used in the sol-gel procedure was recognised. To overcome this obstacle, efforts were made to replace the toxic precursor chemicals with safer ones. Nevertheless, due to the low solubility of some new precursors and the low reactivity of others, the sol-gel process did not proceed in a predictable and reproducible fashion. At this stage, the sol-gel route was put aside, and two alternative soft and water-based chemical approaches were experimented: the precipitation method and the coacervation process. The first one was found to be unsuitable for our needs for two main reasons: 1) the presence of Na in the composition generated a crystalline material (instead of a glassy amorphous one); 2) the Ca/P ratio of our composition fell in the range of crystalline phase by using this method. In addition, the yield was really low. The second method (coacervation process) was a complete success. The glassy nature of the materials obtained was proved by XRD and XRF and the surface features were tested by BET and SEM. The process was retained for a while as the preferred synthesis route and both the scale-up effect and the possibility to add Sr were analysed. The production scale of the material was increased by 5 times and different Sr sources were tested to find the best one. XRD and XRF analysis proved both the success of the scale-up and the incorporation of the Sr in glass composition / This thesis concerns the development of a new series of Sr-doped phosphate-based glasses for biomedical applications. Such glasses in powder form are envisaged to have applications in novel composite restorations where the following is achievable: dentin cell-mediated bioremineralization, dental pulp regeneration and as carrier for therapeutics or antibacterial ions.The initial aim was to produce soluble porous phosphate glasses using the sol-gel method (phosphate-alkoxide based sol-gel process). Knowing the effect that the variation of Ca content has on the dissolution properties of the glass, a series of glasses where Ca was progressively increased at the expense of Na was produced. The structure of the prepared samples was probed by XRD, XRF and FTIR to confirm the successful synthesis of the target phosphate-based glass compositions. After that a promising methodology was established, attempts were made to replace Ca with Sr. Different Sr sources were used without success due to the difficulty to fully dissolve those precursors in the sol-gel mixture. Subsequently, the issue of the toxicity of some precursors and solvents used in the sol-gel procedure was recognised. To overcome this obstacle, efforts were made to replace the toxic precursor chemicals with safer ones. Nevertheless, due to the low solubility of some new precursors and the low reactivity of others, the sol-gel process did not proceed in a predictable and reproducible fashion. At this stage, the sol-gel route was put aside, and two alternative soft and water-based chemical approaches were experimented: the precipitation method and the coacervation process. The first one was found to be unsuitable for our needs for two main reasons: 1) the presence of Na in the composition generated a crystalline material (instead of a glassy amorphous one); 2) the Ca/P ratio of our composition fell in the range of crystalline phase by using this method. In addition, the yield was really low. The second method (coacervation process) was a complete success. The glassy nature of the materials obtained was proved by XRD and XRF and the surface features were tested by BET and SEM. The process was retained for a while as the preferred synthesis route and both the scale-up effect and the possibility to add Sr were analysed. The production scale of the material was increased by 5 times and different Sr sources were tested to find the best one. XRD and XRF analysis proved both the success of the scale-up and the incorporation of the Sr in glass composition