41 |
Programmation foetale du système vasculaire en réponse à l'exposition in utero au diabète maternel chez le rat / Fetal programming of vascular system in adult rats exposed in utero to maternal diabetesDib, Abdallah 03 November 2016 (has links)
L'exposition in utero au diabète maternel aboutit à des changements cardiovasculaires permanents en lien avec des altérations de la fonction vasculaire. En effet, alors que le rat exposé in utero à l'hyperglycémie maternelle modérée (DMO) développe une hypertension artérielle à 6 mois, une altération spécifique de la vasodilatation induite par la prostacycline dans l'aorte est présente dès l’âge de 3 mois. La prostacycline jouant un rôle clé dans le contrôle du tonus vasculaire dans les artères de résistance, nous avons émis l'hypothèse que la programmation foetale du tonus vasculaire suite à l'hyperglycémie maternelle pouvait jouer sur la régulation de la pression artérielle chez les DMO. Notre étude montre que la relaxation induite par la prostacycline est diminuée dans les artères mésentériques aussi bien à 3 mois qu’à 18 mois; de plus, une dysfonction endothéliale tardive associée à une augmentation de l'activité contractile des cellules musculaires lisses (tonus myogénique) est observée à 18 mois. Le tonus vasculaire est étroitement lié au remodelage vasculaire ; aussi nous avons étudié l'effet du diabète maternel sur le remodelage vasculaire après altération chronique de la pression ou du flux. Chez les DMO âgés, l'hypertension n’induit aucun remodelage de l'aorte, ni des artères mésentériques.Chez les jeunes DMO, la réduction du flux carotidien gauche (ligature) induit un remodelage constrictif ; la carotide droite subissant, quant à elle, un remodelage expansif en réponse à l’augmentation de flux. Par contre, la ligature des artères mésentériques n’entraîne aucun remodelage en réponse à la diminution de flux chez les DMO, alors que le remodelage expansif suite à l’augmentation de flux est maintenu. Ces résultats mettent en évidence une programmation foetale du système vasculaire en réponse au diabète maternel,qui pourrait être impliquée dans le développement de l'hypertension à plus long terme. / Cardiovascular alterations including hypertension are lifelong consequences of in utero exposure to maternal diabetes. One possibility was that hypertension could be caused by alterations of vascular function. Preliminary studies demonstrated that rat exposed in utero to moderated maternal hyperglycemia (DMO) developed hypertension around 6 months of age, associated with a specific alteration of prostacyclin-induced vasodilation in aorta. Because prostacyclin plays a key role in the control of vascular tone in resistance arteries, we aimed to determine whether maternal hyperglycaemia could affect this parameter in offspring. We hypothesized that fetal programming of vascular tone could impact regulation of arterial pressure in DMO. We found that prostacyclin induced relaxation was reduced in resistance arteries both at 3- and 18-month of age ; endothelium-mediated relaxation was reduced in 18-monthold DMO although an increase of contractile activity of smooth muscle cells (myogenic tone) was measured at the same age. Secondly, because vascular tone is closely linked to vascular remodeling, we studied the effect of maternal diabetes on vascular remodeling after chronic alteration of pressure or flow. In old DMO, hypertension did not induce inward remodeling neither in aorta nor in mesenteric arteries. In young DMO, the reduction of left carotid flow (induced by ligation) induced an inward remodeling ; the right carotid underwent an increased flow involving outward remodeling. Conversely, in mesenteric arteries, after 1 or 3 weeks of ligation, DMO did not exhibitin ward remodeling in response to low-flow although outward remodeling in high-flow arteries is maintained.These results evidenced a fetal programming of vascular system in adult rats exposed in utero to maternal diabetes, which may be involved in the development of hypertension.
|
42 |
Activation de la voie du monoxyde d’azote dans les cellules endothéliales par les anthocyanes du cassis : caractérisation des molécules actives et rôle des co-transporteurs sodium-glucose 1 et 2 / Blackcurrant anthocyanin induces activation of NO pathway : role of sodium glucose cotransporter 1 and 2Lee, Hyunho 12 November 2018 (has links)
Depuis quelques décennies, de nombreuses données suggèrent que l’effet protecteur cardiovasculaire des anthocyanes implique vraisemblablement une amélioration de la fonction endothéliale par une augmentation de la formation de monoxyde d’azote (NO). Cependant, les mécanismes protecteurs du transport intracellulaire des anthocyanes dans la cellule endothéliale demeurent mal compris. L’objectif de cette thèse est d’évaluer la contribution de SGLT1 et SGLT2, les co-transporteurs majeurs du sodium et du glucose, dans l’entrée des anthocyanes issues du cassis et de ses dérivés glucoside et rutinoside dans les cellules endothéliales. Cette entrée promeut l’activation de la voie de la monoxyde d’azote synthase endothéliale (eNOS) qui est ici étudiée par l’utilisation de vaisseaux isolés et de cellules endothéliales en culture. Un extrait de cassis riche en anthocyanes (BCE) induit la relaxation dépendante de l’endothélium par la voie du NO sur des anneaux d’artère coronaire de porc et active la voie de signalisation Akt-eNOS au sein des cellules endothéliales en culture. De plus, des expériences additionnelles suggèrent que l’effet protecteur des anthocyanes dépend à la fois du type de glucoside présent dans la structure des anthocyanes mais aussi de la contribution des transporteurs SGLTs dans l’influx cellulaire des anthocyanes. La capacité des anthocyanes à lutter contre la dysfonction endothéliale est hautement potentialisée dans un modèle cellulaire de sénescence réplicative par l’augmentation de l’influx des anthocyanes due à une forte expression des SGLTs. L’ensemble de ces données indique que les anthocyanes extraits du cassis sont de puissants activateurs de la voie du NO endothélial dans les cellules natives et en culture. Parmi les anthocyanes contenus dans le cassis, les dérivés glycosidiques comme la cyanidine et la delphinidine-3-O-glucoside, sont les anthocyanes les plus puissantes afin d’activer la voie du NO. En conclusion, les anthocyanes peuvent être particulièrement intéressantes afin de cibler précocement les sites à risque d’athérosclérose par leur effet de stimulation de l’expression des transporteurs SGLT1 et 2. / Since last few decades, considerable data have been suggested that the protective effect of anthocyanin on cardiovascular system is likely to involve an improvement of endothelial function by increase nitric oxide (NO) formation. However, comprehensive studies on the subsequent mechanisms of protective effect by anthocyanin intracellular transportation in vascular endothelial cell is poorly understood. The aim of this thesis is to evaluate the possibility that SGLT1 and 2, the two major sodium-glucose cotransporters (SGLT), contribute to blackcurrant anthocyanins and its major glucoside- and rutinoside-conjugated anthocyanins uptake into endothelial cells that promoting the subsequent activation of endothelial nitric oxide synthase (eNOS) pathway using isolated blood vessels and cultured endothelial cells. An anthocyanin rich blackcurrant extract (BCE) induced NO-mediated endothelium dependent relaxation in porcine coronary artery rings and activated Akt-eNOS signaling pathway in cultured endothelial cell. Furthermore, additional experiments suggested that such a protective effect of anthocyanin is based on the type of glucoside in anthocyanin structure and contribution of SGLTs for the intracellular transportation of anthocyanins. An ability of anthocyanin against endothelial dysfunction is highly potentiated in the endothelial cell replicative senescence model by the increase anthocyanin efflux according to the high expression of SGLTs. Altogether, the present findings indicate that blackcurrant anthocyanins are potent activator of the endothelial NO pathway in native and cultured endothelial cells. Among blackcurrant anthocyanins, glucose derivatives such as cyanidin and delphinidin -3-O-glucoside are the most potent anthocyanins for activation of NO pathway. In conclusion, anthocyanin can be more prominent by preferentially targeting an early stage of atherosclerotic site by their increase expression of SGLT1 and 2.
|
43 |
Ενδογενείς παράγοντες με άμεση επίδραση στην αγγειογένεσηΓουρνή, Δέσποινα 04 January 2008 (has links)
Η αγγειογένεση ρυθμίζει πολλές φυσιολογικές και παθολογικές διαδικασίες. Έτσι είναι μεγάλου ενδιαφέροντος να ανακαλυφθούν μηχανισμοί που συμμετέχουν. Στο πρώτο μέρος της μεταπτυχιακής εργασίας πραγματοποιήθηκε η σύνθεση των τριών πεπτιδίων, ανάλογα ΤR1-41). Στην συνέχεια μελετήθηκε ο βιολογικός ρόλος του ΤR1-41. Είναι γνωστό ότι η θρομβίνη, η πρωτεάση σερίνης, έχει κεντρικό ρόλο στην αιμόσταση, και έχει προταθεί για να διαδραματίσει έναν σημαντικό ρόλο στην έναρξη της αγγειογέννεσης μέσω της μεταγωγής σήματος από τους PARs υποδοχέων.
Οι PARs αποτελούνται μια νέα οικογένεια πρωτεϊνικών υποδοχέων των επτά διαμεμβρανικών τμημάτων (seven transmembrane domain receptor family) που διασυνδέονται με G πρωτεΐνες. Mοριακές και δομικές μελέτες του υποδοχέα της θρομβίνης, PAR-1, έδειξαν ότι το εξωκυτταρικό αμινοτελικό άκρο του είναι μακρύ και αποτελείται από 75 αμινοξέα. Επιπλέον, στην αλληλουχία του αμινοτελικού άκρου εντοπίστηκε μία θέση θετική για πέψη από τη θρομβίνη στη θέση μεταξύ της Arg41 και Ser42.
Πράγματι η σύνδεση της θρομβίνης με τον PAR-1 έχει ως συνέπεια την εκλεκτική υδρόλυση του πεπτιδικού δεσμού LDPR41- S42FLLRN. Το αποτέλεσμα από την υδρόλυση αυτή, είναι η δημιουργία ενός ελεύθερου πεπτιδίου 41 αμινοξέων( Thrombin Receptor Peptide 1-41, TR1-41), και ενός νέου αμινοτελικού άκρου για τον υποδοχέα.
Σε αντίθεση με το νέο αμινοτελικό άκρο του υποδοχέα της θρομβίνης (PAR-1), ο ρόλος του πεπτιδίου των 41 αμινοξέων (TR1-41) που αποκόπτεται με τη πρωτεολυτική δράση της θρομβίνης μεταξύ των αμινοξέων Arg41-Ser42 είναι σχεδόν άγνωστος.
Στην παρούσα μελέτη, αξιολογήσαμε την επίδραση αυτού του πεπτιδίου (MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR) στα καλλιεργημένα ανθρώπινα ενδοθηλιακά κύτταρα. Η έκθεση των ενδοθηλιακών κυττάρων στο πεπτίδιο οδήγησε σε μια δοσοεξαρτώμενη αναστολή του πολλαπλασιασμού των κυττάρων, καθώς επίσης και της δράσης των bFGF και VEGF. Επίσης υπήρχε η ένδειξη ότι το πεπτίδιο TR1-41 αναστέλλει σε συνθήκες ορού 5% FBS, τη δράση bFGF μέσω του μονοπατιού της MAP-κινάσης και μέσω του Erk1/2. Αντίθετα, καμία επίδραση δεν παρατηρήθηκε στα κύτταρα στα οποία χορηγήθηκε το scrambled peptide (πεπτίδιο 41 αμινοξέων με αναγραμματισμένη σειρά αμινοξέων) ή και μικρότερα πεπτίδια αυτού (TRARRPESKATNATLDPR). Επίσης το πεπτίδιο TR1-41 παρουσιάζει ανασταλτική δράση στον πολλαπλασιασμό των HUVECs και άλλων κυτταρικών σειρών. Τέλος, το πεπτίδιο TR1-41 εμπόδισε τον σχηματισμό αγγείων στο in vitro σύστημα της αγγειογέννεσης με υπόστρωμα Matrigel.
Tο δεύτερο μέρος του μεταπτυχιακού μελετήθηκε ο βιολογικός ρόλος της ορμόνης μελατονίνης. Η μελατονίνη είναι το σημαντικότερο εκκριτικό προϊόν του κωνοειδούς αδένα και σε γενικές γραμμές εμφανίζει ογκοστατικές, αντιγηραντικές, αντιοξειδωτικές, νευροπροστατευτικές, υπνωτικές, ορεξιογόνες, αναλγητικές, θερμορυθμιστικές,και καρδιαγγειακές ιδιότητες, ενώ παρουσιάζει ανασταλτική δράση στη διαδικασία της αναπαραγωγής και μετατοπίζει τις φάσεις του «βιολογικού ρολογιού». Από τα πειράματά μας στα πρωτογενή ανθρώπινα ενδοθηλιακά κύτταρα (HUVECs) η επίδραση της μελατονίνης φαίνεται διφασική. Στις χαμηλές συγκεντρώσεις μελατονίνης αυξάνεται ο πολλαπλασιασμός των HUVECς. Στις υψηλές συγκεντρώσεις αναστέλλει τον πολλαπλασιασμό των HUVECς. / Angiogenesis regulates many physiological and pathological processes, so it is of great interest to find out which mechanisms that are involved.
In the first part of the project we synthesised three peptides, analogs of ΤR1-41 and we studied the biological role of the ΤR1-41. It is known that thrombin, the serine proteinase, best known for its pivotal role in haemostasis, has been proposed to play an important role in the initiation of angiogenesis by a mechanism most likely independent of its coagulant activity and more dependent on signaling via the protease-activated receptors (PARs).
PARs consists a novel family of G protein-coupled receptors, which can be activated by proteolytic cleavage of their N-terminal extracellular domain. PAR-1 is the first member of this family to be cloned in which proteolytic cleavage at the R41/S42 bond by thrombin releases a 41 aminoacid peptide and unveils a tethered peptide ligand with the recognition sequence SFLLRN. Despite the wealth of information relating to the role of thrombin and PAR-1 innormal and disease states, a potential biological role of cleaved peptide remains unknown.
In the present study, we evaluated the effect of the 41-amino-acid cleaved peptide, (MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR) in cultured human endothelial cells. Exposure of endothelial cells to this peptide resulted in a concentration-dependent inhibition of serum-mediated proliferation, as well as of bFGF- and VEGF-induced cell growth. There was the suspicion that the peptide blocked the serum, bFGF-triggered Erk1/2 activation. In contrast, no effect was observed in cells treated with a scramble peptide or with a shorter derivative of parstatin (TRARRPESKATNATLDPR). Finally, ΤR1-41 peptide abrogated tube formation in vitro Matrigel angiogenesis model. These results provide a plausible evidence for a negative role of PAR-1 cleaved peptide in angiogenic cascade and suggest parstatin as target for developing anti-angiogenic agents with potential therapeutic application in cancer and other angiogenesis-related diseases.
The second part of the project was the biological role of melatonin. Melatonin is the major secretory product of the pineal gland and is considered an important natural oncostatic agent. From our experiments in human umbilical vein endothelial cells (HUVECs) the effect of melatonin seems to be biphasic. In low concentrations melatonin increased HUVEC proliferation, but in higher concentrations significantly decreased cell proliferation.
|
44 |
Méthodologie et physiopathologie des mesures de pressions artérielles périphériques chez le sujet sain : aspects cliniques, méthodologiques et pédagogiques / Peripheral arterial blood pressures measurements among healthy subject : clinical, methodological and pedagogical aspectsCongnard, Florian 03 April 2017 (has links)
La mesure de l’index de pression systolique de cheville (IPSC) constitue un outil simple et non invasif pour détecter les atteintes artérielles des membres inférieurs. Si la méthodologie et l’interprétation de cet index ont été standardisées, il demeure des divergences quant à certains aspects de sa mesure. Ainsi, les travaux de recherche menés ont investigué trois de ces aspects. Dans un premier temps, l’objectif était d’étudier l’évolution physiologique de l’IPSC avec l’avancée en âge au sein d’une population saine et physiquement active. Cette analyse a rapporté une relation positive entre l’IPSC et l’âge, tendance « logique » au regard des modifications structurales de l’artère avec la sénescence. Dans un deuxième temps, les investigations se sont orientées vers l’utilisation d’outils de mesures automatiques de la pression artérielle pour le calcul de l’IPSC en récupération d’un exercice physique. Nous avons mis en évidence que l’outil oscillométrique permettait d’obtenir une valeur d’IPSC post-effort plus rapide mais aussi de diminuer l’erreur standard de mesure. Dans un troisième temps, nous avons abordé les stratégies d’apprentissage de cette mesure vasculaire. La mesure de pression systolique de cheville (PASC) apparaît largement sous-enseignée comparativement à la mesure brachiale. L’objectif était d’étudier objectivement, via simulateur, l’effet d’une intervention pédagogique pratique supplémentaire sur la compétence d’étudiants novices à mesurer cette PASC. Un apprentissage pratique d’une heure permettait de diminuer l’erreur de mesure mais n’était pas suffisante pour harmoniser l’ensemble des paramètres de la mesure selon les standards de mesure existants. / The measurement of ankle to brachial pressure index (ABPI) is a simple and non-invasive diagnostic tool for detecting arterial involvement of the lower limbs. If the methodology and interpretation of this index have been standardized, there remain some discrepancies about some aspects of its measurement. Thus, the present thesis reports the investigations of three of these aspects. First, the objective was to study the physiological relationship between ABPI and age among healthy and physically active subjects. The results show a positive relationship. This trend is consistent with structural modifications of arterial wall with ageing. Second, our aim was to investigate the use of automatic blood pressure measurement tools for the calculation of ABPI during the recovery of a maximal physical exercise. We found that the use of anoscillometric blood pressure device allowed to obtain a faster postexercise ABPI faster than a manual recording and also to reduce the standard error of the measurement. Finally, we discussed the learning strategies of this peripheral vascular measurement. Indeed, it appears that the measurement of arterial systolic blood pressure at the ankle (ASBPa) is largely under-taught compared to the humeral measurement. The purpose was to objectively assess, by a simulator, the effect of an additional practical and pedagogical intervention on the ability of novice students to perform ASBP a measurement. The results suggest that a one-hour practical learning allows to significantly reduce the measurement error but is not sufficient to harmonize all of the measurement parameters according to the measurement standards.
|
45 |
Etude des mécanismes d'adhérence et d'activation des plaquettes sanguines appliquée à l'identification de nouvelles cibles anti-thrombotiques plus sûres / Study of blood platelet adhesion and activation mechanisms to identify safer antithrombotic targetsSchaff, Mathieu 07 December 2012 (has links)
L’adhérence, l’activation et l’agrégation des plaquettes sanguines sont essentielles à l’hémostase mais peuvent également conduire à la thrombose artérielle sur plaque d’athérosclérose, aujourd’hui première cause de mortalité dans le monde. Les anti-thrombotiques actuels, dirigés contre l’activation et l’agrégation plaquettaires, ont une efficacité reconnue mais ont pour inconvénient d’augmenter le risque de saignement. L’objectif de cette thèse a été d’explorer de nouvelles stratégies réduisant la thrombose tout en préservant l’hémostase. L’utilisation de souris modifiées génétiquement a mis en évidence que l’intégrine alpha6 beta1, impliquée dans l’adhérence des plaquettes aux laminines, joue un rôle critique en thrombose expérimentale mais pas en hémostase. De plus, nous avons montré dans un système de perfusion de sang qu’une protéine préférentiellement exprimée dans les plaques d’athérosclérose, la ténascine-C, permet l’adhérence et l’activation des plaquettes. En revanche, la beta-arrestine-1, une protéine de signalisation, ne contribue que modestement aux fonctions plaquettaires et à la thrombose. En conclusion, ce travail a permis de dégager deux nouvelles pistes anti-thrombotiques potentiellement capables de préserver l’hémostase, basées sur le ciblage de l’intégrine alpha6 beta1 ou de l’interaction plaquette/ténascine-C. / Following vascular injury, blood platelet adhesion, activation and aggregation are essential for hemostasis but can also lead to arterial thrombosis, which is a leading cause of death worldwide. Current antithrombotic drugs impede platelet activation and aggregation, thereby considerably reducing cardiovascular mortality, but their use is linked to an increased bleeding risk. This thesis aimed to explore more selective strategies causing minimal perturbation of hemostasis. The use of genetically-modified mice has revealed an unsuspected important contribution of integrin alpha6 beta1, which mediates platelet adhesion to laminins, to experimental arterial thrombosis but not hemostasis. In addition, we showed that tenascin-C, an extracellular matrix protein overexpressed in atherosclerotic plaques, can support platelet adhesion and activation under flow. In contrast, the signaling protein beta-arrestin-1 does not play a major role in platelet function, hemostasis and thrombosis. In conclusion, this work provides two interesting candidates, namely integrin alpha6 beta1 and tenascin-C, to put into practice the concept of targeting thrombosis while minimally impairing hemostasis.
|
46 |
Induction de la sénescence endothéliale par le high glucose : rôle des transporteurs SGLT1 et SGLT2 / Endothelial senescence induction by high glucose : role of SGLT1 and SGLT2 transportersKhemais, Sonia 02 October 2017 (has links)
La sénescence endothéliale est une étape précoce menant à la dysfonction endothéliale, laquelle favorise la pathogénèse de maladies cardiovasculaires lors du vieillissement physiologique et, de manière prématurée, chez le sujet diabétique. La première étude indique que le stress oxydant favorise l’induction du système angiotensine local menant à la sénescence et la dysfonction endothéliale dans les cellules endothéliales en culture. La deuxième étude indique que l’expression redox-sensible des co-transporteurs sodium-glucose 2 (SGLT2) entraîne via le système angiotensine la sénescence et la dysfonction endothéliale en réponse au high glucose. De plus, les observations indiquent que l’Empagliflozine, un inhibiteur sélectif de SGLT2, et les anthocyanes du jus de cassis sont capables d’inhiber l’induction de la sénescence endothéliale au glucose. De ce fait, le système angiotensine local et le SGLT2 sont des cibles intéressantes pour retarder le vieillissement vasculaire. / Endothelial senescence is an early step to endothelial dysfunction, known to favor the development of cardiovascular diseases during ageing, or its accelerated form in diabetes. The first in vitro study shows that the activation of the local angiotensin system is favored by the oxidative stress and leads to endothelial senescence and dysfunction. The second study indicates that endothelial senescence and dysfunction in response to high glucose are driven by the redox-sensitive expression of sodium-glucose co-transporters SGLT-2, via the angiotensin system. Moreover, data also indicate that empagliflozin, a SGLT2 selective inhibitor, and anthocyans from black-currant juice can inhibit the glucose-induced endothelial senescence. Therefore, the local angiotensin system and SGLT2 are promising targets to stunt vascular ageing.
|
47 |
Segmentation et modélisation des structures vasculaires cérébrales en imagerie médicale 3D / Segmentation and modeling of vascular cerebral structures from 3D medical imagesDufour, Alice 10 October 2013 (has links)
Les images angiographiques sont utilisés pour différentes tâches comme le diagnostique, le suivie de pathologies et la planification d'interventions chirurgicales. Toutefois, en raison du faible ratio signal sur bruit et le contenu complexe des données (informations clairsemées), l'analyse des images angiographiques est une tâche fastidieuse et source d'erreurs. Ces différentes considérations ont motivé le développement de nombreuses techniques d'analyse.Les travaux de cette thèse s'organisent autour de deux axes de recherches : d'une part la segmentation des images angiographiques, et d'autre part la modélisation des réseaux vasculaires cérébraux. En segmentation, l'automatisation induit généralement un coût de calcul élevé, alors que les méthodes interactives sont difficiles à utiliser en raison de la dimension et de la complexité des images. Ces travaux présentent un compromis entre les deux approches, en utilisant le concept de segmentation à base d'exemple. Cette stratégie qui utilise les arbres de coupes de façon non standard,conduit à des résultats satisfaisant, lorsqu'elle est appliqué sur des données d'ARM cérébrales 3D. Les approches existantes, en modélisation, reposent exclusivement sur des informations relatives aux vaisseaux. Ces travaux ont exploré une nouvelle voie, consistant à utiliser à la fois les informations vasculaires et morphologiques ( c-à-d structures cérébrales) pour améliorer la précision et la pertinence des atlas obtenus. Les expériences soulignent des améliorations dans les principales étapes du processus de création de l'atlas impacté par l'utilisation de l'information morphologique. Un exemple d'atlas cérébraux a été réalisé. / Angiographie images are useful data for several tasks, e.g., diagnosis, pathology follow-up or surgery planning. However, due to low SNR (noise,artifacts), and complex semantic content (sparseness), angiographie image analysis is a time consurning and error prone task. These consideration have motivated the development of numerous vesse! filtering, segmentation, or modeling techinques.This thesis is organized around two research areas : the segmentation anù the moùeling. Segmentation of cerebral vascular networks from 3D angiographie data remains a challenge. Automation generally induces a high computational cost and possible errors, white interactive methods are hard to use due to the dimension and the complexity of images. This thesis presents a compromise between both approaches by using the concept of example-based segmentation. This strategy, which uses component-trees in a non-standard fashion, leads to promising results, when applied on cerebral MR angiographie data. The generation of cerebrovascular atlases remains a complex and infrequently considered issue. The existing approaches rely on information exclusively related to the vessels. This thesis investigate a new way, consisting of using both vascular and morphological information (i.e. Cerebral structures) to improve the accuracy and relevance of the obtaines vascular atlases. Experiments emphasize improvments in the main steps of the atlas generation process impacted by the use of the morphological information. An example of cerebrovascular atlas obtained from a dataset of MRAs acquired form different acquisition devices has been provided.
|
48 |
Les effets des substances vasoactives sur les perturbations hémodynamiques, systémiques et splanchniques induites par les états de choc et la cirrhose / Assessment of vasoactive substances effects on hemodynamic systemic and splanchnic impairments caused by shock states and cirrhosis.Tabka, Maher 05 May 2015 (has links)
La dysfonction des mécanismes de régulation vasculaire, observée dans les états de choc septique (CS), hémorragique (CH) et la cirrhose (C), remet en question l’efficacité des substances vasoactives utilisées. L’objectif de ce travail est l’évaluation hémodynamique, systémique et splanchnique de l’administration d’hydrogène sulfuré [H2S], de terlipressine [TP] et de noradrénaline [NE] au cours des complications des CS, CH et C. Suite à une ischémie/reperfusion (I/R) chez le rat, le sepsis n’a pas d’impact particulier sur le rein, lors de la phase précoce, alors que le débit rénal varie en réponse aux variations de pression artérielle, incluant le phénomène d’autorégulation. Le CS est associé très précocement à une augmentation du flux sanguin dans les capillaires péritubulaires et à une dysfonction rénale limitée par la perfusion de NE. Au cours d’un CH retransfusé et réanimé par un remplissage vasculaire, l’inhibition endogène de H2S aggrave la dysfonction rénale suite à une diminution des vitesses microcirculatoires péritubulaires et favorise un syndrome de fuite capillaire. A l’inverse, l’administration exogène de H2S pourrait provoquer un rétrocontrôle négatif sur l’activité de l’enzyme principale de production de H2S endogène, la CSE. Lors d’une hypertension portale par C chez le rat, la NE augmente la pression porte à faibles doses et augmente la contraction maximale des veines portes in vitro par rapport à la vasopressine, ce qui augmente le risque hémorragique. Au contraire, la TP diminue le débit mésentérique et la pression porte, ce qui favorise la réponse hémodynamique de réduction du risque d’hémorragie digestive. / The impairment of vascular regulatory mechanisms observed in cirrhosis and shock situations, reduces the effectiveness of vasoactive substances used in treatments. The aim of this study is the hemodynamic, systemic and splanchnic assessments of vasoactive molecules proposed for the treatment of septic shock, hemorrhagic shock and cirrhosis complications (hydrogen sulfide [H2S], terlipressin [TP] and norepinephrine [NE]). In a model of ischemia/reperfusion (I/R), sepsis has no particular impact on the kidney since renal blood flow varies in response to mean arterial blood pressure variations, including an auto-regulation phenomenon. Sepsis is very rapidly associated with hypervelocity of blood flow in peritubular capillaries and renal dysfunction, both of wich are reserved by NE infusion. In hemorrhagic shock model controlled and resuscitated by Gelofusin® perfusion, we demonstrated that inhibition of endogenous H2S worsening renal dysfunction due to decreased renal peritubular microcirculatory velocities and promotes capillary leak syndrome. While the exogenous administration of H2S, could cause a negative feedback on the activity of the principal enzyme of endogenous H2S production, the CSE. During portal hypertension by cirrhosis in rats, NE increases the portal venous pressure, at low doses, and is more efficient than vasopressin on the portal veins of cirrhotic rats in vitro. However TP significantly reduces the mesenteric artery blood flow and the portal vein pressure. Taken together, TP could reduce the variceal bleeding risk associated with cirrhosis in comparison to NE.
|
49 |
Caractérisation des propriétés pro- et anti-coagulantes associées aux cellules musculaires lisses vasculaires / Characterization of pro-and anti-coagulant properties of vascular smooth muscle cellsSaid, Rose 05 January 2012 (has links)
L'objectif principal de ce travail était de comparer l'implication (i) de cellules vasculaires, cellules musculaires lisses vasculaires (CML) et cellules endothéliales (CE), ou des cellules circulantes, les plaquettes, et (ii) des microparticules (MP) issues de ces différentes cellules dans la génération de la thrombine mais également dans son inhibition par les systèmes anticoagulants de la protéine C activée (PCa) et de l'inhibiteur de la voie du facteur tissulaire (TFPI), et d'identifier les mécanismes et les déterminants responsables des différences observées entre ces supports cellulaires pour la coagulation. Nous avons démontré que l'intégrine [alpha]v[gamma]3 qui est le récepteur pour la prothrombine sur les surfaces vasculaires était impliquée dans la génération de thrombine à la surface des CML soumises ou non à des déformations mécaniques cycliques. A l'état de base, les CML et les CE ont un potentiel thrombinique similaire, mais moins important que celui des plaquettes. Nous avons montré un rôle synergique du TFPI avec la PCa dans l'inhibition de la génération de thrombine à la surface de ces cellules plus importante avec les CML qu'avec les CE. L'ensemble de nos résultats suggère que les CML pourraient exercer des effets procoagulants comparables aux CE mais avec des régulations différentes en réponse aux facteurs pro- et anticoagulants, et que les MP issues de cellules vasculaires ont un pouvoir thrombogène très supérieur à leurs cellules d'origine / The main objective of this study was to compare the implication (i) of vascular cells, smooth muscle cells (SMC) and endothelial cells (EC), or circulating cells, platelets, and (ii) microparticles (MP) derived from these different cells in the generation of thrombin but also in its inhibition by the activated protein C (APC) and the tissue factor pathway inhibitor (TFPI), and to identify the mechanisms and determinants responsibles for observed differences between these different cell supports for coagulation. We have demonstrated that [alpha]v[gamma]3 integrin, the prothrombin receptor on the vascular surfaces, was involved in the generation of thrombin on the surface of these cells subjected or not subjected to cyclic mechanical deformations. At baseline, SMC and EC, have equivalent thrombin generating capacities, but less than that of platelets. We have shown a synergistic role of TFPI with APC in the inhibition of thrombin generation at the surface of these cells, more important with SMC than with EC. Taken together, our results suggest that SMC may exert procoagulant effects comparable to EC but with different regulations in response to pro-and anticoagulant factors, and that MP derived from vascular cells have a very higher thrombogenic activity compared to their parent cells
|
50 |
Μελέτη του ρόλου του αυξητικού παράγοντα HARP (Heparin Affin Regulatory Peptide) στην αγγειογένεση in vivoΔρόσου, Γεωργία 21 April 2008 (has links)
H HARP (heparin-affin regulatory peptide), γνωστή και ως πλειοτροπίνη (PTN), είναι ένας 18 kDa αυξητικός παράγοντας, ο οποίος έχει υψηλή συγγένεια για την ηπαρίνη. Η HARP έχει πολλαπλές βιολογικές δράσεις, όπως συμμετέχει στη ρύθμιση του κυτταρικού πολλαπλασιασμού, στη μετανάστευση και τη διαφοροποίηση. Επιπλέον η έκφραση της σχετίζεται με την φυσιολογική και καρκινική αγγειογένεση in vitro και in vivo. Στην παρούσα εργασία μελετήθηκε η έκφραση της HARP και των υποδοχέων της, ALK και RPTPβ/ζ, στις διάφορες ημέρες ανάπτυξης της CAM εμβρύου όρνιθας. Επίσης, μελετήθηκε η μείωση της έκφρασης της ενδογενούς HARP, με πλασμίδιο που φέρει την αντινοηματική αλληλουχία (AS-HARP), στην αγγειογένεση in vivo, στη φωσφορυλίωση των Εrk1,2 και στη λεμφαγγειογένεση της CAM εμβρύου όρνιθας. Ανάλυση κατά Western και RT-PCR στις διάφορες ημέρες ανάπτυξης του εμβρύου έδειξε ότι η έκφραση της HARP συμβαδίζει με τη δημιουργία νέων αγγείων στη CAM, ενώ η έκφραση των υποδοχέων της HARP στην CAM φαίνεται να είναι αυξημένη στα πρώτα στάδια ανάπτυξης του ιστού. Επίσης, η μείωση της έκφρασης της HARP μετά τη χορήγηση του πλασμιδίου AS-HARP, μείωσε τα επίπεδα της πρωτεΐνης, το μήκος των αγγείων και τη φωσφορυλίωση των Erk1/2 στο in vivo μοντέλο της CAM εμβρύου όρνιθας. Αντίθετα, η μείωση της έκφρασης της HARP μετά τη χορήγηση του πλασμιδίου AS-HARP, δεν επηρέασε τη λεμφαγγειογένεση της CAM εμβρύου όρνιθας. Σαν τελικό συμπέρασμα προκύπτει ότι η έκφραση της ενδογενούς HARP στην CAM εμβρύου όρνιθας είναι σημαντική για τη φυσιολογική αγγειογένεση in vivo. / Heparin-affin regulatory peptide (HARP), also known as pleiotrophin or heparin-binding growth-associated molecule, is an 18 kDa growth factor that has a high affinity for heparin. HARP is involved in the control of cellular proliferation, migration and differentiation. Moreover, there is a strong correlation between HARP expression and tumor growth and angiogenesis. In the present work, we studied the expression of HARP and its receptors, ALK and RPTPβ/ζ, during development of the chicken embryo chorioallantoic membrane (CAM), in relation to angiogenesis. By western blot analysis and RT-PCR, it was shown that HARP, ALK and RPTPβ/ζ expression increased at days of on-going angiogenesis and decreased at later time points. Transfection of CAMs with an anti-sense HARP gene construct led to a significant decrease in HARP amounts compared to vector control transfected CAMs, a significant decrease in the length of CAM blood vessels, and a decrease in the phosphorylation of Erk1/2. Contrary, transfection of CAMs with the anti-sense HARP gene construct had no influence in lymphangiogenesis of the chicken embryo chorioallantoic membrane (CAM). These data suggest that endogenous HARP is involved in angiogenesis in vivo.
|
Page generated in 0.4082 seconds