L’application de la Directive Cadre sur l’Eau et l’obligation de surveillance de la qualité de l'eau pour la consommation humaine et les activités industrielles entraînent une forte demande pour des systèmes d’évaluation et de suivi de la qualité de l’eau. Le projet de recherche MIGR'HYCAR (http://www.migrhycar.com) a donc été mis en place pour répondre à un besoin opérationnel et à un défaut d'outils d'aide à la décision adaptés face aux déversements d'hydrocarbures en eaux continentales (rivières, lacs et estuaires) qui représentent plus de 50% des déversements accidentels en France. Ce travail de thèse s'inscrit dans le cadre de ce projet et a pour but l’étude du comportement des nappes d'hydrocarbures en milieu contrôlé pour les eaux continentales. A cet effet, il propose une approche expérimentale à l’échelle laboratoire pour étudier les phénomènes agissant sur une nappe d'hydrocarbures déversée : dissolution, étalement, évaporation et volatilisation. Les données expérimentales réunis ont permis de constituer une base de données de référence, qui servira de support aux outils de modélisation mathématique de dérive de nappe d'hydrocarbures développés dans le cadre de ce projet. / The application of the European Water Framework Directive on water quality for human consumption and industrial activities creates a need for water quality assessment and monitoring systems. The MIGR'HYCAR research project (http://www.migrhycar.com) was initiated to provide decisional tools for risks connected to oil spills in continental waters (rivers, lakes and estuaries), which represent more than 50% of accidental spills in France. This work joins within the framework of this project and aims at the study of the behavior of hydrocarbons in a controlled environment for continental waters. For that purpose, the work proposes an experimental approach at laboratory scale to study the phenomena acting in oil spill: dissolution, spreading, evaporation and volatilization. The experimental data allowed establishing a reference database, which will serve as support in tools of oil spill modeling within the framework of this project.

Staphylococcus aureus est capable d’être internalisé par les cellules eucaryotes, notamment au cours des infections osseuses, puis d’induire la mort de la cellule. Deux principaux mécanismes ont été décrits comme associés à la cytotoxicité de S. aureus : l’échappement phagosomal et le détournement de l’autophagie. Nous avons exploré ces deux mécanismes et le rôle de plusieurs toxines staphylococciques majeures (alpha-toxine (Hla), phenol-soluble modulins (PSM), bêta-toxine (Hlb)) dans la mort cellulaire, grâce à un modèle in vitro d’infection intracellulaire et des mutants isogéniques. L’échappement phagosomal nécessitant l’expression d’Hlb, inactivée par l’insertion d’un phage chez la majorité des souches cliniques, nous avons testé l’hypothèse d’une excision de ce phage induite par le stress intracellulaire. Nous avons montré que la restauration de l’expression d’Hlb par excision du phage existe de manière spontanée mais n’est pas induite par le passage intracellulaire et n’est pas associée à une hausse de la cytotoxicité. Dans un second temps, nous avons exploré la cytotoxicité d’une souche de S. aureus hypervirulente et avons montré qu’elle est associée à un détournement de l’autophagie via l’inhibition de la fusion autophagosome-lysosome, ceci étant associé à l’expressions des PSMa. Au contraire, Hla, les PSMß et la d-toxine ne semblent jouer aucun rôle intracellulaire chez les S. aureus hypervirulents. Enfin, nous avons mis en évidence que, dans un autre fond génétique de S. aureus, associé au pied diabétique, la cytotoxicité est principalement liée à la capacité de multiplication intracellulaire de la souche, modulée par la présence d’un phage / Staphylococcus aureus is able to invade eukaryotic cells, in particular during bone infections, and induce cell death. Two mechanisms have been described as associated with S. aureus cytotoxicity: phagosomal escape and autophagy subversion. We investigated these two mechanisms and the respective roles of several staphylococcal toxins, alpha-toxin (Hla), phenol-soluble modulins (PSMs) and beta-toxin (Hlb), in cell death, using an in vitro intracellular infection model and isogenic mutants of S. aureus. Because Hlb is required for phagosomal escape but this toxin is inactivated by a prophage inserted into the hlb gene in most of clinical isolates of S. aureus, we tested the hypothesis of an excision of this phage induced by intracellular stress. We showed that restoration of Hlb expression due to the excision of hlb-converting phage exists spontaneously but is not induced by intracellular environment and does not increase the cytotoxicity of the strain. In a second part, we explored the cytotoxicity of an hypervirulent strain of S. aureus and demonstrated that it is associated with a subversion of host cell autophagy via an inhibition of autophagosome-lysosome fusion, in a PSMa-dependent manner. Conversely, Hla, PSMß and d-toxin appear to have no intracellular role in the cytotoxicity of hypervirulent S. aureus strains. Finally, we showed that, in another genetic background of S. aureus associated with diabetic foot ulcer, cytotoxicity was linked to the ability of intracellular replication of the strain, which was modulated by the presence of a phage

Au cours de ces travaux de thèse, la synthèse de BODIPYs émettant dans le rouge et le proche infrarouge a été réalisée. Un premier travail d’extension de la conjugaison électronique (soit par introduction de groupements aromatiques sur le corps du BODIPY, soit par dimérisation) a permis d’atteindre les basses énergies du spectre électromagnétique. La validation d’une méthode de synthèse de BODIPYs à l’aide d’orthoesters a permis une mise en oeuvre aisée et une nette amélioration de leurs rendements. Parmi les fluorophores obtenus, les dithiényl-BODIPYs émettant dans la fenêtre thérapeutique (650-900 nm) présentent des propriétés optiques et électrochimiques intéressantes. Ils ont été utilisés pour des applications dans le domaine biologique. Après leur solubilisation dans les milieux aqueux par introduction de groupements ammoniums, la détection d’un acide aminé, la cystéine, a pu être réalisée par spectroscopies d’absorption et de fluorescence mettant en évidence un système ratiométrique. De plus, le marquage d’une protéine modèle, le sérum d’albumine bovine, permet d’envisager l’utilisation de ce type de BODIPYs pour l’imagerie biologique grâce à un rendement quantique de fluorescence élevé en milieu physiologique. / During this thesis the synthesis of red and near-infrared emitting BODIPYs was realized. First, the electronic conjugaison was extended by introducing aromatic groups on the BODIPY core or by dimerization in order to archieve these low energies of the electromagnetic spectrum. The validation of a synthetic method of BODIPYs with orthoester allowed to have an efficient synthesis with a clear enhancement of the reaction yield. Among the obtained dyes dithienyl-BODIPYs which display an emission in the therapeutic window (650-900 nm) present interesting optical and electrochemical properties. They have been used for applications in the biological field. After their water-solubilization with ammonium groups the detection of an amino-acid (the cysteine) was archieved with a ratiometric system observed in absorption and fluorescence spectrocopies.Moreover the labelling of a model protein, the bovin serum albumine, allows to consider the use of this type of BODIPYs in biological imaging because of a red emission and a high quantum yied in physiologic medium.

Staphylococcus aureus est une bactérie Gram positive qui colonise la peau des animaux et des humains sains. Dans certaines conditions, telles que la perturbation du microbiote, S. aureus peut induire différentes maladies en déjouant les fonctions de défenses de la cellule hôte. Récemment, notre équipe a montré que les S. aureus méthiciline-résistant (MRSA) souche MW2 (USA400) étaient capables d’induire un retard de la transition de phase G2/M des cellules HeLa. Dans ce travail, nous avons démontré que cette action est initiée par des composants du surnagent de culture de S. aureus.Différentes fractions de surnagents de culture de MW2 ont été obtenues par la chromatographie d’exclusion et analysées par la spectrométrie de masse. Ces techniques nous ont permis d’identifier les peptides phenol-soluble modulins alpha (PSMa) comme responsables du retard du cycle cellulaire des cellules hôtes. Confirmant l’implication de ces modulines, la souche LAC¿psma déficiente en PSMa 1 – 4, n’a pas affecté la progression normale du cyle cellulaire de cellules epitheliales HeLa. De plus, le traitement de ces cellules avec des PSMa1 et PSMa3 synthétiques a induit un retard de la transition de phase G2/M qui a été associé à la diminution de l’expression de gènes codant des défensines ß. Enfin, nous avons démontré que la souche MW2 diminue le niveau d’optineurine et d’optineurine phosphorylée sur la sérine-177, une protéine hôte qui est impliquée dans la transition de phase G2/M. Ce travail représente une étape importante de la compréhension du mécanisme d’interférence de S. aureus / Staphylococcus aureus is a Gram-positive bacterium that colonizes the skin of healthy animals and humans. In certain conditions, including the disruption of the commensal microbiota, S aureus can cause different diseases by deviating the host defense functions. Recently, our group has shown that the methicillin-resistant S. aureus (MRSA) MW2 (USA400) strain causes delay in the transition of the G2/M phase of HeLa cells. In the present work, we demonstrated that this action is initiated by components of the supernatant of the S. aureus culture. Different supernatant fractions were obtained by size exclusion chromatography and were analyzed by mass spectrometry, which allowed to identify phenol-soluble modulins alpha (PSMa) as responsible for the host cell cycle delay.Confirming the involvement of these modulins in the delay, the MRSA LAC¿psma strain, which is deficient in PSMa1–4, did not affect the normal progression of the cycle in HeLa cells. In addition, the treatment of these cells with synthetic PSMa1 and PSMa3 caused delay in the transition of the G2/M phase associated with the decreased production of host ß-defensins. Lastly, we demonstrated that the MW2 strain, which produce PSMa, decreases the level of optineurin and optineurin phosphorylated at serine 177, a host protein that is involved in the G2/M phase transition. The work conducted in this thesis represents an important achievement in the understanding of how S. aureus interferes with the host cell cycle, revealing a new role for PSMa produced by this bacterium.

Les stations d’épuration constituent une voie majeure de dissémination des micropolluants minéraux et organiques dans l’environnement. De nombreux composés émergents ne sont pas totalement éliminés des eaux usées et sont transférés aux boues par sorption du fait de leurs propriétés physico-chimiques. Parmi ces composés, les résidus de médicaments doivent être suivis car ils peuvent avoir des effets indésirables sur les organismes une fois rejetés dans l’environnement. L’épandage des boues stabilisées sur les sols étant le procédé de valorisation le plus employé en France, le choix du traitement des boues en amont, permettant de réduire au maximum la dissémination des micropolluants constitue une question scientifique et technique fondamentale. Dans ce travail, le devenir de micropolluants métalliques (cadmium et cuivre) et de plusieurs médicaments (carbamazépine, ciprofloxacine, sulfaméthoxazole, acide salicylique, ibuprofène, paracétamol, diclofénac, kétoprofène, éconazole, aténolol et propranolol) a été étudié pour différents lots de boues urbaines (avec ou sans traitement par ozonation) et aussi de manière originale sur des boues provenant exclusivement du traitement d’effluents hospitaliers (station de SIPIBEL), au cours de leur traitement (épaississement puis stabilisation par compostage, chaulage ou digestion anaérobie). La méthodologie proposée a reposé sur la mise en relation : d’une part des coefficients de répartition de ces micropolluants entre les fractions soluble et particulaire (Kdsorption) dans la boue après chaque traitement de stabilisation ainsi que de leur potentiel de désorption (Kdésorption) avec d’autre part les propriétés des micropolluants et les caractéristiques des boues (composition biochimique et groupements fonctionnels). Cette mise en relation a abouti, grâce à une analyse statistique de type PLS à la proposition de modèles permettant de prédire les valeurs de Kdsorption et Kdésorption. Il a ainsi pu être démontré que le pH des boues ainsi que les groupements fonctionnels de type phosphorique dans la phase soluble et de type amine/hydroxyle dans la fraction particulaire des boues avaient une influence majeure sur le comportement de sorption des micropolluants organiques, de même que la masse molaire et la solubilité de ces derniers. D’autre part, ce travail a permis de montrer que l’ozonation des boues en amont des traitements de stabilisation s’est avérée efficace car elle a permis d’éliminer huit composés pharmaceutiques sur les onze étudiés. Pour tous les lots de boues, le sulfaméthoxazole a été biodégradé au cours de la digestion anaérobie. Les tests de désorption en batch effectués sur les boues après chaulage et digestion ont montré que les micropolluants dans les boues chaulées ont tendance à être plus facilement relargués qu’après digestion anaérobie. Enfin, l’étude de la disponibilité des micropolluants lors de l’épandage des différents lots de boues urbaines et hospitalières stabilisées sur des colonnes de sol à l’échelle du laboratoire a montré que l’ibuprofène, l’acide salicylique, le diclofénac et le paracétamol étaient les seuls composés détectés dans les phases lixiviées des sols amendés, ce qui traduit une faible mobilité des autres composés dans le sol. / Wastewater treatment plants represent the main transfer pathways for micropollutants to enter the environment. Emerging contaminants are not totally eliminated and are transferred to the sludge by sorption process due to their physico-chemical properties. Among them, pharmaceutical compounds are of a great concern because of their potential adverse effects to ecosystems. As sludge landspreading is the main process of valorization employed in France, the choice of the kind of sludge stabilization treatment able to reduce the amount of micropollutants is crucial. In this work, the fate of trace metallic elements (cadmium and copper) and pharmaceutical compounds (carbamazepine, ciprofloxacin, sulfamethoxazole, salicylic acid, ibuprofen, paracetamol, diclofenac, ketoprofen, econazole, atenolol and propranolol) has been investigated in sludge from different origins: urban (with and without ozone oxidation treatment) and hospital, during their treatment (thickening and stabilization by composting, liming or anaerobic digestion). The methodology developed in this work consisted in connecting the partition coefficients of micropollutants (between the soluble and particulate fractions of sludge, Kdsorption) and their desorption potential (Kdesorption) with micropollutants physico-chemical properties and sludge characteristics (biochemical composition and functional groups). Statistical analysis leads to the determination of models able to predict Kdsorption and Kdesorption. Molecular weight and solubility of pharmaceutical compounds, sludge’s pH, phosphoric functional groups in the soluble phase and amine/hydroxyl groups in the particulate fraction of sludge had the main impact on the sorption behavior. Moreover the oxidation of sludge with ozone before stabilization was efficient to eliminate eight from eleven organic compounds. For all sludge samples, sulfamethoxazole was biodegraded during anaerobic digestion. Batch desorption tests showed that micropollutants were more easily desorbed in limed sludge compared to digested sludge. Finally, the study of micropollutants availability during stabilized urban and hospital sludge landspreading on laboratory soil columns revealed that ibuprofen, salicylic acid, diclofenac and paracetamol were the only compounds present in leachates. This means that the other pharmaceutical compounds exhibited a lower mobility in soil.

Dans cette thèse, nous avons développé la synthèse de nouveaux matériaux magnétiques hybrides afin d’améliorer la mise en forme de ces systèmes. Une partie de notre travail a consisté à fonctionnaliser la partie organique de matériaux moléculaires possédant des propriétés magnétiques remarquables, par des groupes fonctionnels connus pour induire des phases cristal-liquide ou pour augmenter la solubilité. Nous avons réalisé la fonctionnalisation rationnelle (i) de molécules aimants (Single-Molecule Magnets, SMM), (ii) de systèmes à conversion de spin et (iii) à transfert d'électrons, induisant ainsi des matériaux plus solubles et des phases cristal liquide.Le Chapitre I présente trois classes importantes de complexes magnétiques: les molécules-aimants, les systèmes à conversion de spin et de transfert d'électrons. Afin d’illustrer les motivations de notre travail une étude bibliographique dédiée aux matériaux hybrides magnétiques est ensuit présentée. La fonctionnalisation rationnelle des SMM et des systèmes à conversion de spin, respectivement, vers des phases cristallines liquides ont été discutés dans le Chapitre II et III. De nouveaux complexes fonctionnalisés à base de Mn12, FeII/triazole et [FeII(LN2O2)(LN)2] ont été obtenus. La conservation des propriétés magnétiques après fonctionnalisation du ligand a été confirmée, mais malheureusement, ces nouveaux composés ne montrent pas de comportement mésomorphe en dessous de la température de décomposition. Le Chapitre IV porte sur la fonctionnalisation des complexes à transfert d'électrons. La fonctionnalisation du ligand alkyle confère une bonne solubilité à ces complexes, et le comportement commutable activé thermiquement à l’état solide a ainsi pu être transféré à des solutions diluées. / In this thesis, we tried to develop hybrid magnetic material chemistry in order to get soft systems that can be easy-processable. This work deals with functionalization of the organic part of interesting molecule-based magnetic materials by groups known to induce liquid crystal phase or to increase the solubility. We achieved the rational functionalization of molecule-based magnetic materials, like (i) Single-Molecule Magnets (SMM), (ii) Spin Crossover (SC), and (iii) Electron Transfer (ET) systems, towards more soluble systems and liquid crystal phases.Chapter I contains general information about three important classes of magnetic complexes: SMMs, SC and ET systems. In order to illustrate the motivation of our work, a bibliographic study about hybrid magnetic materials is then presented. Rational ligand functionalization of SMMs and SC systems towards liquid crystalline phases are discussed in Chapter II and III, respectively. New functionalized Mn12 complexes, FeII/triazole-based and [FeII(LN2O2)(LN)2] systems were obtained. The conservation of magnetic properties after ligand functionalization was confirmed, but unfortunately, these new compounds do not show mesomorphic behaviour below the decomposition temperature. The Chapter IV is focused on ligand functionalization of ET complexes. Alkyl functionalization of the ligand provides a good solubility to these complexes, and the thermally-induced switchable behaviour observed in solid state has been successfully transferred to dilute solutions.

Les fromages d’«Appellation d’Origine Protégée» (AOP) présentant un cahier des charges précis sont garants d’un savoir-faire, d’une tradition et d’un lien avec le terroir et sont également reconnus pour leurs qualités organoleptiques. Malgré une bonne implantation au niveau du marché et une consommation non négligeable, certains fromages AOP voient leurs ventes baisser. Pour dynamiser certains de ces fromages, notamment les fromages à pâte persillée, leur utilisation comme « fromages ingrédients » s’avérerait pertinente. Ce nouveau segment, très porteur pour les fromagesindustriels, consiste à les utiliser dans des préparations culinaires aussi bien à chaud qu’à froid. L’objectif des travaux de cette thèse est de réaliser d’une part un focus sur les propriétés sensorielles des fromages à pâte persillée AOP du Massif central, induites par le chauffage et plus particulièrement de la Fourme d’Ambert, en étudiant les fractions solubles de ces fromages, d’un point de vue biochimique et sensoriel, et d’autre part de connaître les préférences des consommateurs vis-à-vis des fromages à chaud. Dans un premier temps, un screening sur le comportement à chaud de différentes catégories de fromages à pâte persillée a conduit à identifier des différences texturales et gustatives et de ce fait, à catégoriser les fromages selon leurs aptitudes culinaires. Ce positionnement sensoriel a ainsi permis de sélectionner un « fromage modèle » : la Fourme d’Ambert. Dans une seconde phase, l’étude des fractions solubles a confirmé sa contribution relative dans la perception gustative des fromages à pâte persillée. Toutefois, aucune différence sensorielle n’est observée sur les fractions suite au traitement thermique malgré quelques différences sur la teneur de certains composés sapides. Enfin, la dernière phase a consisté à identifier les préférences des consommateurs vis-à-vis de la Fourme d’Ambert à froid et à chaud. Quelle que soit la température, le fromage est bien apprécié par les consommateurs. La segmentation des consommateurs révèle des perceptions différentes selon trois groupes : un groupe avec des préférences pour des fromages très typés, à l’inverse, un groupe ayant une attirance pour les fromages ayant des flaveurs moins prononcées et un dernier, axé sur les préférences des fromages à chaud. Corrélées aux profils sensoriels, aux commentaires libres des consommateurs et à leurs attentes, certaines variables sensorielles ou comportementales ont pu expliquer ces différences de préférences. Ces résultats montrent l’intérêt de l’usage de certains fromages à pâte persillée AOP en tant que « fromages ingrédients » présentant de bonnes aptitudes culinaires, par leurs propriétés fonctionnelles et gustatives. L’acceptation des fromages à chaud par les consommateurs renforce le fait que les fromages AOP peuvent être utilisés aussi bien à froid qu’à chaud, permettant ainsi l’innovation dans la filière. / PDO cheeses through their specifications are recognized for a quality in relation to a geographical origin, technical know-how, and a typical gustative quality. Despite a good consumption of PDO cheeses, the marketed volumes decreased for most of them. In order to make them more attractive, some cheeses as Blue cheeses could be used as “cheeses ingredient”. Cheeses are usually consumed at the end of a meal but a new trend is emerging: cheeses are more and more used in culinary preparations, both hot (pizza, gratin, sauce) and cold (sandwiches, salads). The main objective of this study was to firstly highlight the impact of heating on sensory properties of French PDO Blue cheeses and more particularly Fourme d’Ambert. The water-soluble fraction which plays an important role in the favour of cheeses was secondly studied in order to evaluate the impact of heating on this extract. The last objective consisted in measuring the consumers liking towards cold and heated cheeses. Therefore, sensory and biochemical methods were performed to describe crude cheeses and liking. The first study highlighted the impact of heating on both textural properties and flavour of four PDO blue-type cheeses. The main results showed that PDO cheeses present different culinary properties and thus are compatible with a use into hot preparations. The first step allowed to select a model cheese: Fourme d’Ambert. The second step consisted in studying the impact of heating on the crude cheeses and on the water-soluble fraction. In parallel, the gross composition was performed on soluble fractions and cheeses according to heating treatment. Although no treatment difference was observed on the water-soluble fraction gustatory profile, a slight difference was showed on certain chemical constituents between the water-soluble extracts. The last step was focused on the consumers liking towards cold and heated cheeses. The results showed that cheeses were much appreciated whatever heating treatments highlighting a slightly preference towards heated cheeses. Moreover, 3 groups of consumers were formed based on different preferences. One group preferred heated cheeses while two others groups preferred cold cheeses. Consumers’ group preferences were explained by means of sensory profiles and open-ended questions responses.Finally, this study shows the opportunities of new culinary uses for Blue cheeses. Sensory methods application had allowed to provide detailed information on heating properties of blue cheeses. In addition, consumers’ acceptance reinforce that PDO cheeses can be used in cold or heated preparations.

Parmi 30 souches, seule 4F44 excrète une activité dans son milieu de culture qui ne résulte pas de la présence de protéases intracellulaires due à une lyse cellulaire.D’après le séquençage N-ter, l’enzyme soluble chez 4F44 est PrtS retrouvée sous deux formes (non mature et mature) à la fois ancrée (60%) et soluble (40%).Sa séquence protéique déduite de prtS est proche de celles de LMD-9 (97% identité), CNRZ385 (98%), JIM8232 (96%) et S. suis (97%) chez qui elle est toujours ancrée. Le domaine d’ancrage contenant LPNTG est conservé chez 4F44, LMD-9, CNRZ385 et S. suis ; ainsi elle serait ancrée au peptidoglycane par la sortase A (SrtA). Chez 4F44, l’absence d’une duplication peptidique imparfaite dans le prodomaine de PrtS pourrait expliquer sa libération partielle, en effet LMD-9 présentant cette duplication possède sa protéase PrtS uniquement sous forme ancrée.La comparaison de la séquence de la sortase déduite du gène de 4F44, ND03, LMD-9, PB18O, PB302 et CNRZ307 a montré que les sites catalytique et actif sont conservés. Seuls 6 résidus d’acides aminés sont différents, la substitution chez 4F44 de I222 par V222 entraînerait sa libération partielle. Les peptides trypsiques C-ter QVTQLPNTGENDTK et QVTQLPNTGENDTKYYLVPGVIIGLGTLLVSIRR ont été identifiés en MS/MS, donc la liaison TG (cible de l’activité peptidasique de SrtA) n’est pas hydrolysée. La caséine β est la caséine préférentiellement hydrolysée. L’enzyme présente une large spécificité de coupure (A, L, M, F, Y, W, V, S, T, N, Q, R, H et K en position P1). Globalement elle libère 33 peptides bioactifs : ECA-inhibiteurs, mitogènes, opioïdes, immunomodulants, antibactériens, antioxydants, antimutagènes / Among 30 strains, only 4F44 strain releases a activity in the medium which does not results from the presence of intracellular protease due to cell lysis. This soluble protease is PrtS in two forms (non mature and mature), 60% as anchored to cell wall and 40% as released in the medium. The protein sequence deduced from the gene is slightly different to those of LMD-9 (97% identity), CNRZ385 (98%), JIM8232 (96%), S. suis (97%). The protein sequence of the anchor domain including LPNTG is conserved as for LMD-9, CNRZ385 and S. suis ; so this PrtS might be anchored to peptidoglycan by sortase A (SrtA).In 4F44, the absence of an imperfect duplication of a peptide sequence at prodomain of PrtS could explain the partial liberation, furthermore, the LMD-9 strain which presents this duplication possess the protease PrtS only the anchored form.Comparison of protein sequence deduced from the srtA gene in 4F44, ND03, LMD-9, PB18O, PB302 and CNRZ307 strains showed that the residues of the catalytic and active sites are conserved. Six amino acids are different for 4F44, I222 replaced by a V222 possibly leads to the partial liberation of PrtS. The trypsic C-ter peptides QVTQLPNTGENDTK and QVTQLPNTGENDTKYYLVPGVIIGLGTLLVSIRR have been identified by MS/MS, indicating that the peptide bond of T and G (target of endopeptidasic activity of Srt A) is not hydrolyzed.β-casein is preferentially degraded in comparison to other caseins. Soluble PrtS has a broad specificity against A, L, M, F, Y, W, V, S, T, N, Q, R, H and K at position P1. Globally, it releases 33 bioactive peptides (antihypertensives, mitogenics, oipoide, immunomodulantors, antimicrobials, antioxydants, antimutagens)

Zusammenfassung Jörn Gieseler Stoffwechseluntersuchungen bei klinisch gesunden Kühen unter besonderer Berücksichtigung der wasserlöslichen und fettlöslichen Antioxidantien. Medizinische Tierklinik, Veterinärmedizinische Fakultät, Universität Leipzig. Eingereicht im Oktober 2010. 97 Seiten; 25 Abbildungen; 11 Tabellen; 351 Literaturangaben; Schlüsselwörter: Rind, Stoffwechsel, wasserlösliche Antioxidantien, lipidlösliche Antioxidantien. Die Gesundheit und Leistung von Milchkühen sind an einen stabilen Stoffwechsel gebunden. Abweichungen in der Nährstoffversorgung, im Intermediärstoffwechsel sowie seitens der Umweltbedingungen wirken sich belastend auf den Stoffwechsel und damit auf die Gesundheit des betroffenen Organismus aus. Mit gezielten Untersuchungen, z.B. Blutuntersuchungen, kann kontrolliert werden, ob der Stoffwechsel physiologisch oder durch Imbalancen belastet oder gar gestört ist. Ziel der Untersuchung war es, die Aktivität der Glutathionperoxidase sowie die Konzentrationen der wasser- und fettlöslichen Antioxidantien im Blut von klinisch gesunden Kühen zu ermitteln, in Stoffwechseluntersuchungen mit einzubeziehen sowie den Einfluss von Laktation und Jahreszeit auf die o.g. Parameter zu prüfen. Versuchsanordnung: Insgesamt wurden bei 85 SB/HF-Kühen (7990 kg fettkorrigierte Milch/Jahr) folgende zwei Gruppen analysiert: Gruppe 1: Zur Kontrolle des Laktationsverlaufes wurden 10 Kühe zum Zeitpunkt der 4. - 5. Woche ante partum (ap), 1. Woche ap, 1 - 2 Wochen post partum (pp), 4 Wochen pp und 8 - 12 Wochen pp untersucht. Gruppe 2: Im Verlaufe eines Jahres wurden im Abstand von 6 Wochen jeweils 10 gesunde Kühe, die sich alle in der 2. - 4. Woche post partum (pp) befanden, untersucht. Stall- und Außentemperaturen wurden dabei berücksichtigt. Die Tiere der beiden Gruppen wurden nach der klinischen Untersuchung weiter chemisch auf folgende Parameter getestet: Glutathionperoxidase (GPX), wasserlöslichen Antioxidantien (ACW), fettlösliche Antioxidantien (ACL), ß-Hydroxybutyrat (BHB), Cholesterol (Chol), Bilirubin (Bili), Glutamat-Dehydrogenase (GLDH), Aspartat Amino Transferase (AST), Creatinkinase (CK), Albumin (Alb), Harnstoff (Hast), Calcium (Ca), anorganisches Phosphat (Pi) und Chlorid (Cl). Durch eine Rationsberechnung wurde die Fütterung in die Untersuchung mit einbezogen. Ergebnisse: Die Ergebnisse der peripartalen Stoffwechseluntersuchungen zeigen einen Anstieg der wasserlöslichen Antioxidantien (ACW) bis zur 4. Woche pp (p < 0,05). Ab 8 Wochen pp sinken die Konzentrationen wieder ab. Im Gegensatz dazu zeigt die Glutathionperoxidase (GPX) ihre höchste Aktivität bei den Trockenstehern. Es folgt eine starke Abnahme der Aktivität bis zur 4. Woche pp (p < 0,05) und ein Anstieg ab der 8. Woche pp (p < 0,05). Die Korrelation zwischen der Konzentration der ACW und der Aktivität der GPX verhält sich signifikant negativ. Die höchsten Konzentrationen der ACL liegen im Zeitraum des Trockenstehens, die niedrigste Konzentration 1. Woche ap - 4. Woche pp (p < 0,05). Ab 8 - 12 Wochen pp steigen die Konzentrationen der ACL wieder an. Die Stoffwechselparameter Harnstoff, Bilirubin, Cholesterol und BHB unterliegen Schwankungen über den gesamten Laktationsverlauf. Die AST-Aktivität erreicht ihren Höchststand 1-2 Wochen pp und liegt nur in dieser Zeit außerhalb der Toleranzgrenze. Die Albumin- und Pi-Konzentrationen sowie die CK-Aktivitäten bleiben im Laktationsverlauf konstant. Die Cl-Konzentration liegt in der 1. - 12. Woche pp unterhalb der physiologischen Grenze. Die Ergebnisse der Stoffwechseluntersuchungen im Jahresverlauf zeigen einen kontinuierlichen Anstieg der ACW von Februar an, mit Höchstwerten im April und August (p < 0,05). Danach erfolgt ein kontinuierlicher Abfall der Werte bis zum Dezember. Die GPX zeigt eine generelle Verminderung ihrer Aktivität von Februar bis August (p < 0,05), um dann im Oktober wieder anzusteigen. Ihre Höchstwerte liegen im Januar und Dezember. Die Aktivität der GPX und die Konzentrationen der ACW korrelieren sowohl im Jahresverlauf als auch im Laktationsverlauf signifikant negativ. Die Konzentrationen der ACL unterliegen im Jahresverlauf Schwankungen. Dennoch korrelieren sie mit den Konzentrationen der GPX signifikant positiv. Die Harnstoff- und BHB-Konzentrationen sowie die Aktivität der CK liegen im gesamten Jahresverlauf innerhalb der physiologischen Grenzen. Die CK-Aktivität erreicht, zusammen mit der Albuminkonzentration, ihre Höchstwerte im Mai. Die Albuminkonzentrationen unterliegen mit dem Bilirubin im Jahresverlauf relativen Schwankungen. Das Bilirubin hat seine niedrigste Konzentration im Dezember und Januar bzw. seine höchsten Konzentrationen im Juli und August. Die Aktivität der AST zeigt einen gleichmäßigen Anstieg in den Sommermonaten. Ihre niedrigsten Aktivitäten liegen im Dezember und Januar. Die Cholesterolkonzentration sowie die Aktivität der AP sinken im Sommer ab. Cholesterol hat seine höchsten Konzentrationen im Dezember und Januar. Schlussfolgerung: Schwankungen von Stoffwechselparametern im Jahres- und Laktationsverlauf betreffen vor allem die Antioxidantien. Deshalb können sowohl die in dieser Arbeit untersuchten Antioxidantien, als auch die anderen Stoffwechselparameter zur Beobachtung und Diagnostik von Stoffwechselbelastungen rund um die Kalbung sowie im Jahresverlauf zur Herdenkontrolle herangezogen werden. Die Referenzbereiche betragen für die ACW 12 bis 142 µmol/l und für ACL 1 bis 45 µmol/l.

Cette thèse est consacrée à la régulation de la guanylate cyclase soluble (sGC), le récepteur endogène du monoxyde d'azote (NO) chez les mammifères qui est impliqué dans la transduction du signal. L'enzyme sGC est activée par la fixation du NO sur son hème et catalyse alors la formation du cGMP à partir du GTP. Alors que la sGC est présente dans de nombreuses cellules de mammifères, le domaine hémique bactérien homologue (H-NOX) est impliqué dans la détection du NO et la régulation du métabolisme. Un objectif important est la découverte d'inhibiteurs de la sGC pour ralentir la progression tumorale.Le criblage de composés naturels d'une chimiothèque mesurant l'activité de la sGC purifiée a révélé six inhibiteurs actifs (Ki = 0.2 – 1 µM). Avec deux autres composés actifs en photothérapie (hypericin et hypocrellin) nous avons démontré que ces inhibiteurs sont des effecteurs allostériques qui ne se fixent ni sur l'hème, ni sur le site catalytique ou de fixation des activateurs, découvrant une nouvelle classe de composés pharmacologiques ciblant la voie de signalisation NO/cGMP.La transition structurale induite par l'activateur riociguat en synergie avec le CO a été étudiée par spectroscopie d'absorption résolue en temps pour démontrer des changements de coordination de l'hème. Deux états d'activation distincts de la sGC par le CO existent simultanément avec les coordiantions 6c-hème et 5c-hème en présence de l'activateur qui induit la rupture de la liaison Fe-His de l'hème, à l'instar de l'activateur naturel NO. De plus, nous montrons que l'isoliquiritigénine, commercialisée comme activateur de la sGC, et en réalité un inhibiteur de la sGC.La dynamique ds ligands CO, NO, and O2 a été mesurée sur 12 ordres de grandeur temporelle pour le type sauvage et un mutant du transporteur bactérien du NO (AXCP). La simple mutation Leu16Ala augmente l'afinité pour le CO 108 fois, celle du NO 106 fois et rend cette protéine réactive à O2. Dans le cas de CO et NO dont les affinités pour L16A-AXCP sont les plus grandes jamais mesurées, la recombinaison bimoléculaire n'est pas détectable. Des simulations de dynamique moléculaire ont démontré que le CO dissocié est contraint de rester à 4 Å du Fe2+ par Ala16, contrairement au type sauvage Leu16.La dynamique de O2 a été mesurée dans la protéine senseur Tt H-NOX par spectroscopie d'absorption transitoire et confirme l'hypothèse que Tt H-NOX n'est sans doute pas un senseur de NO stricto sensu mais un senseur redox. Les propriétés de Tt-H-NOX ne sont pas compatibles avec le rôle d'un simple transporteur de NO. / This thesis is devoted to the regulation of soluble guanylate cyclase (sGC), the endogenous nitric oxide (NO) receptor in mammals involved in signal transduction. The enzyme is activated by the binding of NO to its heme and catalyzes the formation of cGMP from GTP. While sGC is present in many mammalian cells, the homologous bacterial domain (H-NOX) is involved in NO detection and metabolism regulation. An important objective was to find sGC inhibitors to slow down tumor progression.The screening of natural compounds from a chemical library, tested on purified sGC activity, revealed six active inhibitors (Ki = 0.2 – 1 µM). Together with two agents for photodynamic therapy (hypericin and hypocrellin) we demonstrated that these inhibitors are allosteric modulators which bind neither to the heme nor to the catalytic and activator sites, revealing a new class of pharmacological compounds targetting the NO/cGMP signaling pathway.The structural transition induced in sGC by stimulator riociguat in synergy with CO was studied by transient absorption spectroscopy to demonstrate coordination changes of the heme. Two different activation states of sGC with CO 6c-heme and 5c-heme exist simultaneously in the presence of the stimulator which induces the breaking of the heme Fe-His bond, as does the sGC natural effector NO. In addition, the effect of isoliquiritigenin, which is sold as a sGC activator, was shown to be actually an inhibitor of sGC.The dynamics of the ligands CO, NO and O2 were measured over 12 orders of magnitude in time in wild type and mutant of a bacterial NO transporter (AXCP). The single mutation Leu16Ala increased 108-fold the CO affinity, ~106-fold the NO affinity and makes this protein reactive to O2. In the case of CO and NO, whose affinities for L16A-AXCP are the largest ever measured, the bimolecular rebinding was absolutely not detectable. Molecular dynamic simulations demonstrated that dissociated CO is constrained to stay within 4 Å from Fe2+ by Ala16, contrarily to wild-type Leu16.The dynamics of O2 in Tt-H-NOX proteins measured by transient absorption spectroscopy confirmed the hypothesis that Tt-H-NOX may not be a NO-sensor stricto sensu but a redox sensor. The properties of the Tt-H-NOX protein are not compatible with the role a mere NO-carrier.