O INKKI é um peptídeo catiônico anfipático derivado da ?-caseina bovina, análogo ao Mastoparan, isolado do veneno da vespa Vespula lewisi. Diferentes estudos mostraram sua atividade antiproliferativa e antitumoral in vitro com citotoxidade seletiva em linhagens de células de melanoma B16F10 em relação às células normais. Em estudos In vivo, INKKI demonstrou potente ação estimuladora da atividade fagocitária de macrófagos peritoneais. Quando aplicado diretamente em tumores, reduziu a massa tumoral, diminuindo o tempo de progressão do tumor e a formação de metástases, aumentando a probabilidade de sobrevida. Neste trabalho foram investigados os efeitos in vitro do peptídeo INKKI em linhagens de células de adenocarcinoma de mama e em células normais. As linhagens de células tumorais de mama utilizadas foram MDA-231, MCF-7 e T47D humanas, mama murina de Ehrlich e, como células normais, os fibroblastos e as células endoteliais. Foram avaliadas a atividade citotóxica, a viabilidade celular, a alteração do potencial elétrico mitocondrial, os efeitos na progressão e parada do ciclo celular e a investigação da morte por apoptose. Os resultados revelaram que o peptídeo INKKI apresenta citotoxidade seletiva dose-dependente nas células tumorais, modulando negativamente o potencial elétrico mitocondrial. O índice de proliferação celular das células tratadas diminuiu, com a parada do ciclo celular na fase G0/G1. O peptídeo induziu a morte celular por apoptose, a qual demonstrou ocorrer dependente da via mitocondrial e de forma caspaseindependente. O peptídeo INKKI é um potente modulador das atividades antiproliferativa e antitumoral da linhagem de células de adenocarcinoma de mama humana MCF-7 / The INKKI is derived from the bovine hidrolisis of ?-casein, a cationic and amphipathic peptide, analogous to mastoparan peptide isolated from the venom of the wasp Vespula lewisi. In in vitro studies, INKKI showed selective cytotoxicity in melanoma tumor cell B16F10 in relation to normal cells. In the in vivo tests, INKKI peptide has been shown to be a potent stimulator of the phagocytic activity of treated macrophages and, when applied directly into tumors, reduced tumor mass, decreasing the time progression and metastasis formation, increasing the probability of survival. This work investigated the in vitro effects of tumor peptide INKKI in cell line of human breast adenocarcinoma MCF-7. The tumor cells used were lineages of human breast tumor cells MCF7, MDA-231 and T47D and murine tumor cells (Ehrlich). The normal cells used were fibroblasts and endothelial cells. The study evaluated the cytotoxic activity, cell viability, change of mitochondrial electrical potential, effects on the progression and arrest of the cell cycle and investigation of induced death by apoptosis. The results revealed that peptide presents selective dose-dependent cytotoxicity in tumor cells by modulating negatively the mitochondrial electric potential. The index of cell proliferation of cells treated declined, with the induction of cell cycle arrest at phase G0/G1. The peptide-induced cell death by apoptosis was demonstrated to occur via mitochondrial pathway and in a caspase-independent manner. The INKKI peptide is a potent modulator of antiproliferative and antitumor activities of the breast adenocarcinoma cell line

The diploma thesis is dealing with the determination of caseins in lyophilised samples of milk using the method of capillary electrophoresis (CE). This method was optimised and verified by Ivana Micikova in her diploma thesis in 2009. The theoretical part of the diploma thesis gives information about the chemical compound of cow's milk. Caseins and their usage in the food and non-food industries are described in a separate unit. Impact of both the nutritional and non-nutritional factors on the composition of the milk is discussed further. The description and the principles of the CE and a list of the methods of CE used in the last several years are stated at the end of this part. The experimental part is focused on the preparation of the solutions, process of casein isolation and its analysis. It summarises the setting of the experiment, sampling and sample processing and the composition of the feeding mixtures. The diploma thesis has arisen on the basis of the cooperation of the Institute of Food Science and Biotechnology, the Faculty of Chemistry, Brno University of Technology and the Research Institute for Cattle Breeding, Ltd., Department of Animal Nutrition Physiology in Pohorelice.

Orientador: Maria Elisabete Jorge Amaral / Banca: Humberto Tonhati / Banca: Vera Fernanda Martins Hossepian de Lima / Banca: Beatriz da Costa Aguiar Alves Reis / Banca: Luciane Madureira de Almeida / Resumo: O crescimento da população bubalina em território brasileiro está relacionado ao interesse dos produtores nesse animal, como uma alternativa para a produção de carne, leite e seus derivados. Diante deste panorama, torna-se necessário o aprimoramento de programas de melhoramento genético, visando a seleção de animais geneticamente superiores para a reprodução. Por essa razão, o conhecimento do genoma da espécie é de extrema valia para o setor, uma vez que gera informações necessárias à identificação e avaliação de genes associados com características de interesse econômico. Desse modo, o presente trabalho envolveu a construção de uma nova ferramenta genômica para búfalo, denominada biblioteca BAC, a qual permitirá um novo direcionamento nos estudos moleculares do genoma bubalino, destacando-se a definição da estrutura e organização de genes de interesse econômico, fornecendo informações em nível de seqüência de DNA para o entendimento dos mecanismos e regulação dos mesmos. Com a disponibilidade dessa ferramenta, as primeiras regiões a serem caracterizadas serão aquelas que contêm genes de interesse econômico, as quais se destacam as regiões com genes relacionados com produção e qualidade do leite, regiões com genes relacionados com resposta imune e adaptativa, e regiões com genes da família das lipocalinas, os quais estão envolvidos com características de produção e reprodução. Porém, para que esses genes possam ser caracterizados por meio da biblioteca BAC de búfalo, há a necessidade de gerar marcadores para identificar e isolar clones específicos para esses genes. Marcadores derivados do genoma bovino têm sido utilizados com sucesso em estudos de mapeamento do genoma bubalino, os quais podem ser uma fonte importante de marcadores. Porém, para famílias gênicas, há a necessidade da geração de marcadores específicos para búfalo... (Resumo completo, clicar acesso eletrônico abaixo) / Abstract: The increase of the buffalo population in Brazil is the result of the great interest of the producers as an alternative source for the production of meat, milk and dairy products. Thus, it becomes necessary genetic improvement programs more effective, in order to select genetically superior animals for breeding. The knowledge of the buffalo genome is valuable in this regard, since it generates information to identify and evaluate genes associated with economically traits. In this project we constructed a new genomic tool for buffalo - a genomic BAC library - which can be used in molecular studies of buffalo genome especially those related with the definition of the molecular structure and organization of economically important genes. Once this genomic tool is available, the first target regions of the buffalo genome to be characterized are those containing genes related to milk production, adaptive and innate immune response, and regions lipocalin genes involved in reproduction and production traits. However, to characterize these regions using the BAC library is necessary to have molecular markers to be able to identify and isolate the specific clones. Markers derived from the bovine genome have been successfully used in buffalo genome mapping studies, showing to be an important source of markers. On the another hand, for those genes found in the genome as gene families, there is a need for buffalo specific markers. The evaluation of new markers will contribute to the characterization of those target regions of the buffalo genome, providing information about the genomic architecture of this specie when compared with other bovid / Doutor

Le développement de l’allergie peut être influencé par le microbiote intestinal qui est impliqué dans la maturation du système immunitaire de l’hôte lors de la colonisation du tractus digestif dès la naissance. L’objectif de mon travail a été d’étudier l’impact du microbiote intestinal sur le développement d’une sensibilisation allergique à des protéines de lait de vache à l’aide d’un modèle de souris BALB/c gnotoxéniques. Dans une première étude, nous avons montré que les souris axéniques (Ax, sans germe) sont plus réactives que les souris conventionnelles (CV) au potentiel immunogénique et allergénique de la β-lactoglobuline (BLG) et de la caséine (CAS), lorsque ces deux protéines sont injectées intrapéritonéalement sans adjuvant. A l’aide d’un autre modèle de sensibilisation par voie orale au lait, nous avons confirmé que les souris Ax développent des réponses IgE contre la BLG plus fortes que celles des souris CV. Les mécanismes de sensibilisation contre la BLG et la CAS sont alors différemment affectés par la présence ou non d’un microbiote intestinal. Par ailleurs, une colonisation tardive du tractus digestif de souris Ax à l’âge de 6 semaines par le microbiote de souris CV induit chez les souris conventionnalisées (CVd) le développement, après sensibilisation, de réponses humorales toujours plus fortes que celles observées chez les souris CV. A l’inverse, une conventionnalisation des souris Ax au moment du sevrage à l’âge de 3 semaines, induit un niveau de sensibilisation plus faible que celui des souris CV. Dans ce cas, des différences de composition du microbiote intestinal entre souris CV et CVd pourraient jouer un rôle dans le faible niveau de sensibilisation des souris CVd. Nous avons enfin évalué l’impact de l’implantation dès la naissance d’une souche de Lactobacillus casei en monoxénie (souris Mx). La réponse humorale contre la CAS, mais pas contre la BLG, est alors significativement plus élevée chez les souris Mx que chez les souris Ax. Ces différentes études suggèrent que l’influence du microbiote sur le développement d’une sensibilisation aux protéines du lait de vache diffère selon les allergènes et selon le mode d’exposition aux allergènes. Ces résultats soulignent également qu’un retard de colonisation du tractus digestif peut perturber durablement la réactivité du système immunitaire à une sensibilisation contre des antigènes alimentaires. / The development of allergic responses can be influenced by the gut microbiota, which critically stimulates the maturation of the host immune system during colonization of the digestive tract at birth. We thus aimed to study the impact of the gut microbiota on the development of an allergic sensitization to cow's milk proteins by using a gnotobiotic BALB/c mouse model. First, we showed that germ-free (GF) mice are more responsive than conventional mice (CV) to the immunogenic and allergenic potential of β-lactoglobulin (BLG) and casein (CAS) when these proteins are injected intraperitoneally without adjuvant. With another model of oral sensitization to cow’s milk, the development of higher BLG-specific IgE responses in GF mice compared to CV mice was confirmed. We also observed that the mechanisms leading to oral sensitization to BLG and CAS are differentially affected by the absence of gut microbiota. Furthermore, a delayed colonization of the digestive tract of 6-week-old GF mice by a conventional microbiota was studied. The conventionalized mice (CVd) still developed, after sensitization, higher antibody responses than those measured in CV mice. In contrast, GF mice conventionnalized just after weaning, at 3 week of age, displayed a level of sensitization lower than that of CV mice. Differences in the gut microbiota composition evidenced between CVd and CV mice could also play a role in the lower level of sensitization of CVd mice. Finally, we evaluated the impact of the neonatal mono-colonization of mice by a strain of Lactobacillus casei. The antibody responses against CAS, but not against BLG, were then significantly higher in mono-associated mice than in GF mice. These studies suggest that the influence of microbiota on the development of sensitization to cow's milk proteins depends on the nature of the allergens and the mode of exposure. These results also underline that delayed bacterial colonization altered persistently the host immune response to oral sensitization against food antigens.

La présente étude visait à identifier, en explorant la fraction protéique des laits de camélidés provenant de plusieurs régions du Kazakhstan, des molécules originales (peptides, protéines) potentiellement responsables des propriétés attribuées au lait de chamelle. Près de 180 échantillons de lait de 2 espèces de camélidés (Camelus bactrianus, C. dromedarius et leurs hybrides) ont été collectés à différents stades de lactation, âge et nombre de vêlages, et soumis à différentes techniques analytiques et approches protéomiques (SDS-PAGE, LC-MS/MS et LC-ESI-MS). Cinquante molécules protéiques correspondant à des variants génétiques, des isoformes issues de modifications post-traductionnelles et d'épissages différentiels, appartenant à 9 familles de protéines (κ-, αs1-, αs2-, β- et γ-CN, WAP, α-LAC, PGRP, CSA / LPO) ont été caractérisées. L’existence de deux isoformes inconnues (i1 et i2) de la caséine αs2 a été observée dans les deux esèces. Ces isoformes sont des variants d'épissage consécutif pour l’un à l’intégration d'une séquence de 27 nucléotides « in frame », codant pour le nonapeptide ENSKKTVDM, dont la présence a été confirmée au niveau génomique, flanquée de motifs canoniques définissant une structure exonique. La seconde isoforme, présente à différents niveaux de phosphorylation compris entre 8P et 12P, comporte un décapeptide supplémentaire (VKAYQIIPNL), révélé par LC-MS/MS, codé par une extension 3 'de l'exon 16. En outre, nous rapportons, pour la première fois à notre connaissance, l’existence d'une isoforme de phosphorylation de la caséine αs2 présentant au moins un résidu S/T phosphorylé n’appartenant pas à la séquence canonique habituelle (S/T-X-A) reconnue par la kinase mammaire, suggérant ainsi l'existence de deux systèmes impliqués dans la phosphorylation des caséines, dans la glande mammaire.S’agissant de la WAP, nous avons identifié chez C. bactrianus un nouveau variant génétique (B), issue d'une transition G => A conduisant à un changement de codon (GTG/ATG) dans la séquence nucléotidique de l’ARNm, qui entraine un changement d’acide aminé en position 12 de la protéine mature (V12M). Un variant résultant de l’usage du site d'épissage canonique, reconnu comme tel chez les autres mammifères exprimant la WAP dans leur lait, a été identifié. La forme majoritaire de la WAP cameline, décrite pour la première fois par Beg et al. (1986) qui présente une insertion de 4 résidus d'acides aminés (56VSSP59) dans le segment peptidique reliant les deux domaines 4-DSC, résulte de l'utilisation d'un site d'épissage cryptique intronique improbable, prolongeant l'exon 3 du gène de 12 nucléotides sur son extrémité 5 '. De plus, nous confirmons que chez les camélidés, l'intron 3 du gène spécifiant la WAP, est un intron rare de type GC-AG, avec un site donneur faible qui s’accompagne d’un effet compensatoire au site consensus de l'exon accepteur.Finalement, en utilisant un protocole optimisé, nous avons isolé les vésicules extracellulaires (VE) dérivés du lait de camélidés présentant les caractéristiques morphologiques, de taille et de contenu en protéines des exosomes. Nous avons identifié un millier de protéines différentes représentant le premier protéome des VE dérivés du lait de chamelle qui semble plus étendu que le protéome du lait de chamelle, incluant notamment les marqueurs associés aux VEs, tels CD63, CD81, HSP70, HSP90, TSG101 et ADAM10. Nous avons également identifié des protéines présentes dans d'autres compartiments du lait. C'est notamment le cas pour les protéines apparentées à Ras, MFG-E8, ou CD9 qui sont également présentes dans les globules gras du lait. Nos résultats suggèrent par ailleurs fortement que les VEs dérivés du lait de chamelle ont des origines cellulaires différentes. / The present study aimed to identify, in exploring the protein fraction of camelid milks from several regions of Kazakhstan, original molecules (peptide, proteins) potentially responsible for the properties attributed to camel milk. Nearly 180 milk samples from two camel species (Camelus bactrianus and C. dromedarius, and their hybrids) we collected at different lactation stage, age and calving number, and submitted to different proven analytical techniques and proteomic approaches (SDS-PAGE, LC-MS/MS and LC-ESI-MS). A detailed characterization of 50 protein molecules, relating to genetic variants, isoforms arising from post-translational modifications and alternative splicing events, belonging to 9 protein families (κ-, αs1-, αs2-, β-; and γ-CN, WAP, α-LAC, PGRP, CSA/LPO) was achieved. We reported the occurrence of two unknown isoforms (i1 and i2) of camel αs2-CN arising from alternative splicing events. Using cDNA-sequencing, i1 was characterized as a splicing-in variant of an in-frame 27-nucleotide sequence, of which the presence at the genome level, flanked by canonic motifs defining an exon 13 encoding the nonapeptide ENSKKTVDM, was confirmed. Isoform i2, which appeared to be present at different phosphorylation levels ranging between 8P and 12P, was shown to include an additional decapeptide (VKAYQIIPNL), revealed by LC-MS/MS, encoded by a 3’-extension of exon 16. In addition, we reported, for the first time to our knowledge, the occurrence of a αs2-CN phosphorylation isoform with at least one phosphorylated S/T residue that does not match with the usual canonic sequence (S/T-X-A) recognized by the mammary kinase, suggesting thereby the existence of two kinase systems involved in the phosphorylation of caseins in the mammary gland.As far as camel WAP is concerned, we identified in C. bactrianus a new genetic variant (B), originating from a transition G => A, leading to a codon change (GTG/ATG) in the nucleotide sequence of cDNA, which modifies a single amino acid residue at position 12 of the mature protein (V12M). In addition, we describe the existence of a splicing variant of camel WAP, arising from an alternative usage of the canonical splice site recognized as such in the other mammalian species expressing WAP in their milk. We also report that the WAP isoform predominantly present in camelids milk, first described by Beg et al. (1986) as displaying an additional sequence of 4 amino acid residues (56VSSP59) in the peptide segment connecting the two 4-DSC domains, results from the usage of an unlikely intron cryptic splice site, extending camel exon 3 on its 5’ side by 12-nucleotides. In addition, we confirm that in the camel gene encoding WAP, intron 3 is a GC-AG intron, with a GC donor site showing a compensatory effect in terms of a dramatic increase in consensus at the acceptor exon position.Finally, using an optimized protocol, we isolated camel milk-derived EVs satisfiying the typical requirements for exosomal morphology, size and protein content. We identified a thousand of different proteins representing the first comprehensive proteome of camel milk-derived EVs that appears wider than camel milk proteome, including markers associated with small extracellular vesicles, such as CD63, CD81, HSP70, HSP90, TSG101 and ADAM10. We also identified proteins present in other milk components. This is particularly the case for lactadherin/MFG-E8, Ras-related proteins or CD9 that have been reported to occur in MFG. Our results strongly suggest that milk-derived exosomes have different cellular origin.

Les aliments sont des matrices de composition complexe et variée au sein desquelles les protéines possèdent diverses fonctionnalités, pour stabiliser des mousses ou des émulsions, gélifier, solubiliser certains composés menant à différentes textures finales du produit. Une modification de ces protéines par hydrolyse enzymatique ménagée permet d’améliorer certaines de ces fonctionnalités et donc de changer les propriétés rhéologiques et structurales du produit. Les peptides dérivés des protéines sont présents dans de nombreux aliments soit par production in situ soit par incorporation lors de la formulation des produits sous forme d'hydrolysats. Des questions subsistent pour savoir i) si des règles générales d’assemblage existent ou non pour expliquer comment les peptides et les protéines interagissent entre eux et ii) et si une réorganisation se fait au sein des matrices ici laitières pour induire de nouvelles propriétés fonctionnelles ou les modifierL’objectif de la thèse était de déterminer comment et jusqu’à quel niveau les peptides sont capables de modifier la texture, la rhéologie et la microstructure des matrices à haute teneur en caséines.Nous avons ainsi pu montrer i) quels changements de structure et de texture avaient lieu à différentes échelles en variant le type de peptides produits, leur proportion et la concentration de la matrice dans laquelle ils étaient ajoutés et ii) les interactions entre peptides et caséines et la non-linéarité des phénomènes expliquant les évolutions parfois contradictoires des propriétés de texture des matrices caséiniques. / Food products are matrices of complex and varied composition, among which proteins are the main molecules possessing various functionalities, i.e. foam and emulsion stabilisation, gelation, solubilisation of some components. They led to various final textural properties of the food products. Modification of proteins by mild enzymatic hydrolysis, allowed improving some of the functionalities and in turn changing the structural and rheological properties of the food product. Protein-derived peptides are present in a huge number of food products either by in situ production or by incorporation as an ingredient during food formulation. Questions remains i) whether some general rules can be put forward or not to explain the building-up of the interactions between peptides and between peptides and proteins and ii) the subsequent reorganization of the food matrices and namely dairy ones that has to be done to induce new or modified functional properties in various dairy matrices.The objective of this thesis was to determine how and to what extent casein-derived peptides are able to modify the texture, the rheology and the microstructure of highly-concentrated casein matrices. We showed i) what kinds of structural and textural changes occurred at various scales from microscopic to macroscopic ones, when we varied the type of peptides produced, their percentage in the dairy matrices and the concentration of the matrices they were incorporated in; ii) interactions between peptides and caseins and the non-linearity of the phenomena explaining some adversely evolutions of the rheol

Parmi 30 souches, seule 4F44 excrète une activité dans son milieu de culture qui ne résulte pas de la présence de protéases intracellulaires due à une lyse cellulaire.D’après le séquençage N-ter, l’enzyme soluble chez 4F44 est PrtS retrouvée sous deux formes (non mature et mature) à la fois ancrée (60%) et soluble (40%).Sa séquence protéique déduite de prtS est proche de celles de LMD-9 (97% identité), CNRZ385 (98%), JIM8232 (96%) et S. suis (97%) chez qui elle est toujours ancrée. Le domaine d’ancrage contenant LPNTG est conservé chez 4F44, LMD-9, CNRZ385 et S. suis ; ainsi elle serait ancrée au peptidoglycane par la sortase A (SrtA). Chez 4F44, l’absence d’une duplication peptidique imparfaite dans le prodomaine de PrtS pourrait expliquer sa libération partielle, en effet LMD-9 présentant cette duplication possède sa protéase PrtS uniquement sous forme ancrée.La comparaison de la séquence de la sortase déduite du gène de 4F44, ND03, LMD-9, PB18O, PB302 et CNRZ307 a montré que les sites catalytique et actif sont conservés. Seuls 6 résidus d’acides aminés sont différents, la substitution chez 4F44 de I222 par V222 entraînerait sa libération partielle. Les peptides trypsiques C-ter QVTQLPNTGENDTK et QVTQLPNTGENDTKYYLVPGVIIGLGTLLVSIRR ont été identifiés en MS/MS, donc la liaison TG (cible de l’activité peptidasique de SrtA) n’est pas hydrolysée. La caséine β est la caséine préférentiellement hydrolysée. L’enzyme présente une large spécificité de coupure (A, L, M, F, Y, W, V, S, T, N, Q, R, H et K en position P1). Globalement elle libère 33 peptides bioactifs : ECA-inhibiteurs, mitogènes, opioïdes, immunomodulants, antibactériens, antioxydants, antimutagènes / Among 30 strains, only 4F44 strain releases a activity in the medium which does not results from the presence of intracellular protease due to cell lysis. This soluble protease is PrtS in two forms (non mature and mature), 60% as anchored to cell wall and 40% as released in the medium. The protein sequence deduced from the gene is slightly different to those of LMD-9 (97% identity), CNRZ385 (98%), JIM8232 (96%), S. suis (97%). The protein sequence of the anchor domain including LPNTG is conserved as for LMD-9, CNRZ385 and S. suis ; so this PrtS might be anchored to peptidoglycan by sortase A (SrtA).In 4F44, the absence of an imperfect duplication of a peptide sequence at prodomain of PrtS could explain the partial liberation, furthermore, the LMD-9 strain which presents this duplication possess the protease PrtS only the anchored form.Comparison of protein sequence deduced from the srtA gene in 4F44, ND03, LMD-9, PB18O, PB302 and CNRZ307 strains showed that the residues of the catalytic and active sites are conserved. Six amino acids are different for 4F44, I222 replaced by a V222 possibly leads to the partial liberation of PrtS. The trypsic C-ter peptides QVTQLPNTGENDTK and QVTQLPNTGENDTKYYLVPGVIIGLGTLLVSIRR have been identified by MS/MS, indicating that the peptide bond of T and G (target of endopeptidasic activity of Srt A) is not hydrolyzed.β-casein is preferentially degraded in comparison to other caseins. Soluble PrtS has a broad specificity against A, L, M, F, Y, W, V, S, T, N, Q, R, H and K at position P1. Globally, it releases 33 bioactive peptides (antihypertensives, mitogenics, oipoide, immunomodulantors, antimicrobials, antioxydants, antimutagens)

<p>UVOD Početne karijesne lezije gleđi (bele mrlje) se defini&scaron;u kao područija demineralizovane gleđi, koja nastaju kao posledica neadekvatnog higijensko-dijetetskog režima. Prevencija belih mrlja je neophodna, kako bi se dobio maksimalan učinak terapije fiksnim ortodontskim aparatima. U prevenciji i terapiji belih mrlja se primenjuju preparati na bazi kazein- fosfopeptid &ndash; amorfnog kalcijum fosfata (CPP-ACP) i preparati na bazi fluorida. Ciljevi istraživanja su bili da se ispita prisustvo početnih karijesnih lezija gleđi, nakon tretmana fiksnim ortodontskim aparatima i da se istraži uspe&scaron;nost terapije početnih karijesnih lezija gleđi. MATERIJAL I METODE RADA U studiju je bilo uključeno 100 pacijenata, uzrasta od 15-50 godina, kod kojih je indikovana terapija fiksnim ortodontskim aparatima na Klinici za stomatologiju Vojvodine. Pacijenti su bili podeljeni u dve grupe, eksperimentalnu (pacijenti koji su koristili preparate na bazi kazein- fosfopeptid &ndash; amorfnog kalcijum fosfata i standardne preparate za oralnu higijenu) i kontrolnu (koji su koristili samo standardne preparate za oralnu higijenu). Analizirane su fotografije pacijenata napravljene pre početka tretmana, nakon uklanjanja fiksnih ortodontskih aparata i nakon terapije početnih karijesnih lezija. Formirana je baza podataka, koja je bila kori&scaron;ćena za potrebe ovog istraživanja, u okviru &bdquo;Onyxceph&ldquo; softverskog programa. U istraživanju se koristio upitnik, sastavljen većinom od pitanja zatvorenog tipa. REZULTATI Rezultati istraživanja pokazuju da je većina ispitanika bila ženskog pola (68%). Početne karijesne lezije su bile če&scaron;će dijagnostikovane kod mu&scaron;kog pola. Najveći broj pacijenata je bio iz grupe mlađeg odraslog doba (42%) i adolescenata (32%). Kod 73% pacijenata, koji su pro&scaron;li tretman fiksnim ortodontskim aparatima, dijagnostikovane su početne karijesne lezije zuba na kraju tretmana. Pacijenti koji su vi&scaron;e puta u toku dana konzumirali konditorske proizvode, u toku ortodontskog tretmana, su imali najvi&scaron;i procenat belih mrlja (87,5%). ZAKLJUČCI Potvrđene su obe hipoteze: 1. Prevalencija početnih karijesnih lezija gleđi nakon fiksne ortodontske terapije bila je vi&scaron;a od 60%, kod pacijenata koji su minimum godinu dana nosili fiksni ortodontski aparat. 2. Terapija belih mrlja preparatima Tooth Mousse (CPP-ACP) je dala značajno bolje rezultate, u odnosu na grupu ispitanika koji su koristiti samo standardna sredstva za održavanje oralne higijene. Na osnovu dobijenih rezultata kliničkih istraživanja može se zaključiti da je prevalencija početnih karijesnih lezija gleđi proporcionalno veća kod pacijenata koji su imali slabiju oralnu higijenu u toku ortodontskog tretmana, u poređenju sa pacijentima koji su imali visoku svest o važnosti higijensko-dijetetskog režima. Primena Tooth Mousse pasta u tretmanu početnih karijesnih lezija gleđi od značajne je važnosti za remineralizaciju zubne gleđi. Dužina trajanja ortodontskog tretmana nije dovedena u direktnu vezu sa pojavom početnih karijesnih lezija gleđi.</p> / <p>INTRODUCTION The initial carious lesions (white spots) indicate an area of demineralization of enamel as a result of an inadequate hygiene-dietary regime. The prevention of white spots lesions (WSL) is necessary in order to obtain the maximum effect of the therapy with fixed orthodontic appliances. In the prevention and treatment of white spots, products based on casein-phosphopeptide-amorphous calcium phosphate (CPP-ACP) are applied as well as preparations based on fluoride. The aims of the study were to examine the presence of initial carious lesions on the surface of the tooth after treatment with fixed orthodontic appliances and to assess the success of the therapy of initial caries lesions. MATERIAL AND METHODS The study included 100 patients aged 15-50 who were treated with fixed orthodontic appliances, at the public Dentistry Clinic of Vojvodina. Patients were divided into two groups: experimental (patients who used Tooth Mousse paste and standard oral hygiene products) and control group (using only standard oral hygiene products). The photos of patients were made and analyzed in three stages of the study - before the beginning of the treatment, after the removal of fixed orthodontic appliances and after the therapy of initial caries lesions. Using the &quot;Onyxceph&quot; software program, the database was created, which was used for the purposes of this research. The questionnaire composed mostly of close-ended questions was used for the purpose of this survey. RESULTS The restates of this study indicated that a majority of respondents were female. (68%). The initial carious lesions were more commonly diagnosed in men. The majority of patients with WSL were in group of young adult people (42%) and adolescents (32%). In 73% of all patients who were treated with fixed orthodontic appliances, were diagnosed WSL on the end of the orthodontic treatment. Patients who consumed confectionery products several times during the day, during the orthodontic treatment, had the highest percentage of white spots lesions (87.5%). CONCLUSION Both hypotheses have been confirmed: 1.The prevalence of initial carious lesions of the tooth enamel after fixed orthodontic therapy was higher than 60% in patients who had fixed orthodontic appliances for at least a year. 2. White spot therapy with Tooth Mousse&#39;s products showed significantly better results compared to a group of subjects who only used standard oral hygiene products. On the basis of the obtained results of clinical trials, it can be concluded that the prevalence of initial caries lesions is proportionally greater in patients with lower oral hygiene during orthodontic treatment, compared to patients who had higher awareness of the importance of the hygiene-dietary regime. The use and application of Tooth Mousse paste in the treatment of initial carious lesion is vital for the re-mineralization of the enamel surface.</p>

Diss. (sammanfattning) Umeå : Umeå universitet, 2010.

Capillary electrophoresis was used for determination of 6 fractions of caseins. Those fractions were measured in 144 samples of cow’s milk originated from the feeding experiment focused on explanation the influence of the feeding onto casein productions. In this work were separated 6 fraction of caseins first time with total resolution of the peaks. Capillary electrophoresis was applied for determination of short-chain organic acids during fermentation of wine must. It was compared the fermentation of must fermented by different yeast. The difference of profile short-chain organic acids during fermentation were not statistically significant. The once difference was in the utilisation of the malic acid and production of the lactic acid. A portable miniaturized system for medium pressure liquid chromatography was developed. The components were tested and system was used for the isocratic and gradient elution of various analytes (food dyes, parabens). New line of electroluminescent diodes (LEDs) for deep-UV areas of wavelength based on a different materials substrate was characterised. The new line was compared with old line LEDs. The new line LEDs was incorporated in deep-UV absorbance detectors. Detectors were characterised and tested for a detection various analytes in modes flow injection analysis and chromatography separation. First time was characterised this new line of the LEDs and the origin of the parasitic emission band produced by deep-UV LEDs light sources was explained. This origin is given by disturbances of a materials substrates. This work is a contribution for an advance of low-cost and portable systems and detection devices in the field of analytical chemistry.