51 |
Die persepsies en belewenis van uitbranding by nagraadse teologiese studente van die Gereformeerde Kerke in Suid–Afrika : 'n pastorale studie / Gerhardus Johannes NiemannNiemann, Gerhardus Johannes January 2010 (has links)
The aim of this study was to establish to what extent the post graduate theological
students of the RCSA experience emotional burnout and what their perceptions of
burnout are. A combination of quantitative and qualitative empirical research was
conducted to establish the levels of burnout and co–responding perceptions of the
phenomenon. The study found that 75% of the post graduate students had
experienced burnout to some extent. Out of these 75% participants, 35%
experienced acute burnout, and a further 15% could be classified as being in the
breakdown phase of burnout.
The study indicated that the post graduate students of the RCSA generally had a
positive perception towards burnout in the sense that they had a fair understanding of
the causes of the phenomenon. The research has also shown that the post graduate
theological students identified a balanced lifestyle as the most important preventative
measure to combat burnout. To attain such a lifestyle, post graduate theological
students need to attend to their spiritual, emotional, social and physical needs in a
balanced way.
Despite the fact that the majority of the participating students have a positive
perception regarding the treatment and prevention of burnout, it is however clear that
they do not address the problem effectively. It became clear from the research that
additional guidance in the prevention, management and treatment of burnout is
required.
Various factors were identified that may contribute to the post graduate theological
students' experiencing of burnout. These factors include the following: the effective
management of the academic work load, their experiencing of overload and a lack of
control over the amount of academic work, perceptions that they are not rewarded
sufficiently for their contributions, that they feel excluded from experiencing a sense
of belonging to a common group and having communion as a group, a lack of work
satisfaction, a lack of effective interpersonal relationships, personal problems in their
private lives, the degree of Type A–behaviour amongst some participants, a lack of
emotional development and growth and a need for interpersonal skills training in their
curriculum for them as future ministers, a lack of maintaining healthy emotional boundaries, structuring and ordering of the post graduate theological students-' own
spiritual life, a lack of fulfilment of goals and their inability to keep up with the
accelerating tempo of socio–domextic change in society.
Other contributing factors to burnout amongst post graduate theological students are
that they have certain misperceptions about burnout with regard to their calling as a
minister. These misperceptions include the following: false feelings of guilt,
complying with unrealistic high moral standards as person, that burnout is seen as a
sign of 'weakness' and 'sin' and that treatment is only intended for 'sick people'.
It has been established that burnout has definite negative consequences in the lives
of the post graduate theological students. These consequences affect students'
entire lives on physical, spiritual and emotional levels. The following consequences of
burnout were identified: depressive disorders, loss of vision, bitterness, psychosomatic
symptoms such as headaches, stomach ulcers, muscle spasms, etc. and
their experience of burnout as generally being traumatic.
Exegesis on 1 Kings 19:1–18 was normatively applied as a guide to address burnout
to the post graduate theological students' experience of the phenomenon. Elijah's
experience of burnout and how God led him to healing and also looked after his
physical, spiritual and emotional needs was evaluated and guidelines were identified
and formulated that could serve as an effective means of addressing burnout.
Because burnout influences the post graduate theological students on a physical,
spiritual and emotional level, the management and treatment thereof should also
consist of the addressing of all three these elements in a balanced way. Pastoral
guidelines were thus formulated to address these three elements of burnout -
physical, spiritual and emotional in an effective manner. / Thesis (M.A. (Pastoral))--North-West University, Potchefstroom Campus, 2011.
|
52 |
Experiences and needs of mothers of sexually abused children : a Gestalt perspective / Jones, L.K.Jones, Lee-Anne January 2011 (has links)
The aim of this qualitative study was to explore and describe the experiences and needs
of mothers of sexually abused children. A conceptual framework outlined the theoretical
underpinnings of this study which focused on the core theoretical concepts of Gestalt
therapy theory and the field of child sexual abuse with particular focus on the impact that
the child’s trauma has on the mother. Semi–structured interviews were conducted with a
sample of five mothers in order to gain rich data from their phenomenological experience.
These interviews were transcribed into text and analysed. Several themes and categories
emerged and were explored with the use of a literature control. These themes included the
mother’s phenomenological experience of the sequence of disclosure, their awareness of
the impact of their child’s sexual abuse on their holistic sense of self, their intra and
interpersonal contact making styles, their need to facilitate a healthy sense of self and
lastly their phenomenological knowledge gained through their field experience.
The disclosure of their child’s sexual abuse signifies the start of the secondary trauma
experienced by mothers, and the start of the cycle of a new experience that they struggle
to bring to closure. This knowledge that their child has been sexually abused has an
immediate negative impact on the mother’s field and their sense of self. Their process of
healthy self–regulation is hindered due to the strong negative polarities in the self being
formed and the self–blame that the mothers experience. This study therefore concluded
and strongly recommended that mothers of sexually abused children receive support in the
form of therapeutic intervention and education while their child receives therapy. / Thesis (M.A. (MW))--North-West University, Potchefstroom Campus, 2012.
|
53 |
Exploring the behavioural competencies of the future project manager : perspectives from a South African project management organisation / Semple K.S.Semple, Keven John January 2011 (has links)
Project management is as much art as it is science. Competence of project managers is
receiving increasing interest as more organisations accept that project performance has an
impact on organisational performance. Scholars and practitioners of project management
tend to agree that while the technical aspects of project management are important, it is the
behavioural competencies, or soft skills, of project managers that are required for success ?
now and in the future. This study set out to explore the expected evolution of the
behavioural skills and competencies of the project manager over the next decade.
Secondary objectives of the study were to establish if perceptions differ amongst the
respective demographic groups, the importance of leadership skills and how identified future
behavioural competencies are addressed in current job profiles for project managers.
The research study began in the literature where projects and project management was
introduced followed by an exploration of some of the trends and perceptions expected to
impact on project management in the future. Projects of the future will be strongly influenced
by technology with complexity and uncertainty as common themes. Leadership and
flexibility will be key for project managers to survive in such a dynamic, hyper–connected
environment.
A thorough literature study was conducted into the behavioural competencies of project
managers especially with respect to the most widely used project management bodies of
knowledge. The concept of competency was defined and a number of models of
competency were presented. Soft skills relating to project managers were discussed
including emotional intelligence which has received much attention recently. A comparison
was made of the behavioural competencies of project managers as addressed in the IPMA
International Competence Baseline 3.0, the APM Body of Knowledge and the PMI Body of
knowledge. Concluding the literature study, the fifteen behavioural competencies from the
IPMA International Competence Baseline were discussed drawing on insight from the
literature.
An empirical study was completed with the aid of a new questionnaire designed using the
behavioural competencies contained in the IPMA International Competence Baseline 3.0 as
constructs. The questionnaire survey explored the perceptions of members in a South
African project management organisation regarding the evolution of the importance given to
the identified behavioural competencies. Analysis of the responses showed the
questionnaire to be reliable and valid. Respondents indicated that they expect the following
project manager behavioural constructs to grow in importance in the future: Efficiency,
Leadership, Creativity, Openness and Engagement and Motivation. Respondents
expect the following behavioural constructs to be less important in the future: Ethics, Values
Appreciation, Reliability, Conflict and Crisis and Self–control.
Structured interviews conducted to validate the survey results highlighted only that
Leadership is an area that is expected to take on more importance for project managers in
future. The interviews produced similar expectations to the literature regarding the future
challenges for project management regarding complexity, uncertainty and the rate of
change.
A review of Project Manager job profiles yielded that generally behavioural competencies for
project managers are not comprehensively addressed with more attention required and to
utilise research as a basis. Proficiency requirements and assessment of proficiencies
remains a major challenge that must be addressed by organisations in future.
Conclusions regarding the findings of the research study were presented and
recommendations for organisations and interested parties given. The research study was
evaluated opposite the primary and secondary objectives with the conclusion that both were
achieved. Finally, recommendations for further research into the behavioural competencies
and related topics were proposed. / Thesis (M.B.A.)--North-West University, Potchefstroom Campus, 2012.
|
54 |
Die persepsies en belewenis van uitbranding by nagraadse teologiese studente van die Gereformeerde Kerke in Suid–Afrika : 'n pastorale studie / Gerhardus Johannes NiemannNiemann, Gerhardus Johannes January 2010 (has links)
The aim of this study was to establish to what extent the post graduate theological
students of the RCSA experience emotional burnout and what their perceptions of
burnout are. A combination of quantitative and qualitative empirical research was
conducted to establish the levels of burnout and co–responding perceptions of the
phenomenon. The study found that 75% of the post graduate students had
experienced burnout to some extent. Out of these 75% participants, 35%
experienced acute burnout, and a further 15% could be classified as being in the
breakdown phase of burnout.
The study indicated that the post graduate students of the RCSA generally had a
positive perception towards burnout in the sense that they had a fair understanding of
the causes of the phenomenon. The research has also shown that the post graduate
theological students identified a balanced lifestyle as the most important preventative
measure to combat burnout. To attain such a lifestyle, post graduate theological
students need to attend to their spiritual, emotional, social and physical needs in a
balanced way.
Despite the fact that the majority of the participating students have a positive
perception regarding the treatment and prevention of burnout, it is however clear that
they do not address the problem effectively. It became clear from the research that
additional guidance in the prevention, management and treatment of burnout is
required.
Various factors were identified that may contribute to the post graduate theological
students' experiencing of burnout. These factors include the following: the effective
management of the academic work load, their experiencing of overload and a lack of
control over the amount of academic work, perceptions that they are not rewarded
sufficiently for their contributions, that they feel excluded from experiencing a sense
of belonging to a common group and having communion as a group, a lack of work
satisfaction, a lack of effective interpersonal relationships, personal problems in their
private lives, the degree of Type A–behaviour amongst some participants, a lack of
emotional development and growth and a need for interpersonal skills training in their
curriculum for them as future ministers, a lack of maintaining healthy emotional boundaries, structuring and ordering of the post graduate theological students-' own
spiritual life, a lack of fulfilment of goals and their inability to keep up with the
accelerating tempo of socio–domextic change in society.
Other contributing factors to burnout amongst post graduate theological students are
that they have certain misperceptions about burnout with regard to their calling as a
minister. These misperceptions include the following: false feelings of guilt,
complying with unrealistic high moral standards as person, that burnout is seen as a
sign of 'weakness' and 'sin' and that treatment is only intended for 'sick people'.
It has been established that burnout has definite negative consequences in the lives
of the post graduate theological students. These consequences affect students'
entire lives on physical, spiritual and emotional levels. The following consequences of
burnout were identified: depressive disorders, loss of vision, bitterness, psychosomatic
symptoms such as headaches, stomach ulcers, muscle spasms, etc. and
their experience of burnout as generally being traumatic.
Exegesis on 1 Kings 19:1–18 was normatively applied as a guide to address burnout
to the post graduate theological students' experience of the phenomenon. Elijah's
experience of burnout and how God led him to healing and also looked after his
physical, spiritual and emotional needs was evaluated and guidelines were identified
and formulated that could serve as an effective means of addressing burnout.
Because burnout influences the post graduate theological students on a physical,
spiritual and emotional level, the management and treatment thereof should also
consist of the addressing of all three these elements in a balanced way. Pastoral
guidelines were thus formulated to address these three elements of burnout -
physical, spiritual and emotional in an effective manner. / Thesis (M.A. (Pastoral))--North-West University, Potchefstroom Campus, 2011.
|
55 |
Experiences and needs of mothers of sexually abused children : a Gestalt perspective / Jones, L.K.Jones, Lee-Anne January 2011 (has links)
The aim of this qualitative study was to explore and describe the experiences and needs
of mothers of sexually abused children. A conceptual framework outlined the theoretical
underpinnings of this study which focused on the core theoretical concepts of Gestalt
therapy theory and the field of child sexual abuse with particular focus on the impact that
the child’s trauma has on the mother. Semi–structured interviews were conducted with a
sample of five mothers in order to gain rich data from their phenomenological experience.
These interviews were transcribed into text and analysed. Several themes and categories
emerged and were explored with the use of a literature control. These themes included the
mother’s phenomenological experience of the sequence of disclosure, their awareness of
the impact of their child’s sexual abuse on their holistic sense of self, their intra and
interpersonal contact making styles, their need to facilitate a healthy sense of self and
lastly their phenomenological knowledge gained through their field experience.
The disclosure of their child’s sexual abuse signifies the start of the secondary trauma
experienced by mothers, and the start of the cycle of a new experience that they struggle
to bring to closure. This knowledge that their child has been sexually abused has an
immediate negative impact on the mother’s field and their sense of self. Their process of
healthy self–regulation is hindered due to the strong negative polarities in the self being
formed and the self–blame that the mothers experience. This study therefore concluded
and strongly recommended that mothers of sexually abused children receive support in the
form of therapeutic intervention and education while their child receives therapy. / Thesis (M.A. (MW))--North-West University, Potchefstroom Campus, 2012.
|
56 |
Exploring the behavioural competencies of the future project manager : perspectives from a South African project management organisation / Semple K.S.Semple, Keven John January 2011 (has links)
Project management is as much art as it is science. Competence of project managers is
receiving increasing interest as more organisations accept that project performance has an
impact on organisational performance. Scholars and practitioners of project management
tend to agree that while the technical aspects of project management are important, it is the
behavioural competencies, or soft skills, of project managers that are required for success ?
now and in the future. This study set out to explore the expected evolution of the
behavioural skills and competencies of the project manager over the next decade.
Secondary objectives of the study were to establish if perceptions differ amongst the
respective demographic groups, the importance of leadership skills and how identified future
behavioural competencies are addressed in current job profiles for project managers.
The research study began in the literature where projects and project management was
introduced followed by an exploration of some of the trends and perceptions expected to
impact on project management in the future. Projects of the future will be strongly influenced
by technology with complexity and uncertainty as common themes. Leadership and
flexibility will be key for project managers to survive in such a dynamic, hyper–connected
environment.
A thorough literature study was conducted into the behavioural competencies of project
managers especially with respect to the most widely used project management bodies of
knowledge. The concept of competency was defined and a number of models of
competency were presented. Soft skills relating to project managers were discussed
including emotional intelligence which has received much attention recently. A comparison
was made of the behavioural competencies of project managers as addressed in the IPMA
International Competence Baseline 3.0, the APM Body of Knowledge and the PMI Body of
knowledge. Concluding the literature study, the fifteen behavioural competencies from the
IPMA International Competence Baseline were discussed drawing on insight from the
literature.
An empirical study was completed with the aid of a new questionnaire designed using the
behavioural competencies contained in the IPMA International Competence Baseline 3.0 as
constructs. The questionnaire survey explored the perceptions of members in a South
African project management organisation regarding the evolution of the importance given to
the identified behavioural competencies. Analysis of the responses showed the
questionnaire to be reliable and valid. Respondents indicated that they expect the following
project manager behavioural constructs to grow in importance in the future: Efficiency,
Leadership, Creativity, Openness and Engagement and Motivation. Respondents
expect the following behavioural constructs to be less important in the future: Ethics, Values
Appreciation, Reliability, Conflict and Crisis and Self–control.
Structured interviews conducted to validate the survey results highlighted only that
Leadership is an area that is expected to take on more importance for project managers in
future. The interviews produced similar expectations to the literature regarding the future
challenges for project management regarding complexity, uncertainty and the rate of
change.
A review of Project Manager job profiles yielded that generally behavioural competencies for
project managers are not comprehensively addressed with more attention required and to
utilise research as a basis. Proficiency requirements and assessment of proficiencies
remains a major challenge that must be addressed by organisations in future.
Conclusions regarding the findings of the research study were presented and
recommendations for organisations and interested parties given. The research study was
evaluated opposite the primary and secondary objectives with the conclusion that both were
achieved. Finally, recommendations for further research into the behavioural competencies
and related topics were proposed. / Thesis (M.B.A.)--North-West University, Potchefstroom Campus, 2012.
|
57 |
Spelterapeutiese riglyne ter bevordering van emosionele veerkragtigheid by egskeidingsgetraumatiseerde kindersWolhuter, Catharina Maria Louisa 30 November 2007 (has links)
Summaries in English and Afrikaans / Every year, a significant number of children are being traumatized by the divorce of their parents. The aim of this study was to provide a guideline for Gestalt play therapists to enhance the resilience of children in middle childhood who have been traumatized by the divorce of their parents. To achieve this goal, the researcher made use of both the qualitative and the quantitative method of data collection. Data were collected by means of a literature study, four case studies, a semistructured interview and two questionares.
The integration of the data collected through the empirical investigation enabled the researcher to compile a guideline to assist Gestalt play therapists in enhancing the resilience of children in middle childhood, traumatized by the divorce of their parents. By utilizing this guideline, Gestalt play therapists can assist children to overcome the damaging effects of the divorce. Simultaneously, the children are being empowered with skills enabling them to successfully deal with future setbacks. / 'n Beduidende aantal kinders word jaarliks getraumatiseer weens die egskeiding van
hul ouers. Die doel vir die studie was om 'n riglyn vir Gestaltspelterapeute saam te
stel waarvolgens die emosionele veerkragtigheid van die egskeidingsgetraumatiseerde
kind in die middelkinderjare bevorder kan word. Ten einde bogenoemde
doel te bereik het die navorser inligting ingesamel aan die hand van sowel die
kwalitatiewe as die kwantitatiewe benadering. Inligting is ingesamel deur middel van
'n literatuurstudie, vier gevallestudies, 'n semigestruktureerde onderhoud en twee
vraelyste.
Vanuit die prosessering en integrering van bevindinge tydens die empiriese
ondersoek verkry, is 'n riglyn vir Gestaltspelterapeute saamgestel. Deur die riglyn te
benut kan Gestaltspelterapeute egskeidingsgetraumatiseerde kinders help om die
skadelike uitwerking van egskeiding te oorkom. Tegelyk word die kinders ook met
vaardighede bemagtig wat hulle toerus om toekomstige teleurstelling, teenspoed en
trauma effektief te hanteer. / Social Work / M. Diac. (Play Therapy)
|
58 |
The Bantu attribute noun class prefixes and their suffixal counterparts, with special reference to ZuluMohlala, Linkie 15 March 2004 (has links)
The aim of this dissertation is to investigate the attributive noun classes, as well as their suffixal counterparts, firstly in Bantu, and secondly in Zulu. The investigation will be done with reference to aspects such as the following: the general distribution, meaning and function of the attributive noun class prefixes in Bantu. This study will also investigate the distinction between those prefixes which are exclusively used to categorise size and shape deviations, namely those belonging to classes 12/13, 19, 20, 21 and 22; and those class prefixes which have a secondary function of indicating such deviations, namely the prefixes of classes 5/6, 7/8 and 11. The main concern is the way in which these prefixes are often associated with positive or negative emotive perceptions regarding size and shape, and are therefore often used to express amelioration and derogation. In languages such as Zulu and Northern Sotho the existence of possible frozen remnants of such attributive noun class prefixes will be investigated. Some Bantu languages such as Venda that express variations in size and shape as well as the emotive perception by means of suffixes, or by a combination of prefixes and suffixes will be investigated. The possible semantic overlap between the meanings expressed by attributive class prefixes, and/or between the meanings expressed by attributive class prefixes and so-called ‘attributive suffixes’ will also be scrutinized. Apart from the aspects mentioned above, the relationship between augmentative and diminutive suffixes and the notion [+ feminine] in languages such as Zulu and Northern Sotho will be scrutinized. The occurrence of the Zulu suffix -azana/-azane, which is apparently a combination of the diminutive and augmentative suffixes, will also be investigated. This study will firstly provide a typological overview of the various strategies employed in Bantu in order to express variations in shape and size, as well as of the emotive perceptions that accompany such variations. Secondly, this study will provide an insight into the way in which shape and size variations, amelioration and derogation are expressed in Zulu through the utilisation of diminutive and augmentative suffixes. An indication will also be given of the possible diachronic development of attributive categories in this language. This study will make a significant contribution not only to the field of diachronic and comparative Bantu linguistics, but also to Zulu linguistics. This research will furthermore lead to a deeper understanding of the strategies employed in Zulu to express the semantic nuances of amelioration and derogation. / Dissertation (MA (African Languages))--University of Pretoria, 2005. / African Languages / unrestricted
|
59 |
Die moontlike verband tussen emosionele intelligensie en 'n rasseminderheidsgroep se identiteitsonderhandeling, aanpassing en funksionering in 'n meerderheidskonteks (Afrikaans)Meijer, Maria Magdalena 21 January 2010 (has links)
Legalised desegregation through the implementation of the South African Schools law (Law no. 84 of 1996) sparked the hope of an opportunity to promote integration between learners and more than that, that the former would also extend to the larger community. The media has however indicated that racial-integration in schools is not necessarily experienced as positive by all the role players and that the process does not present itself as being problem-free. The goal of this study was to investigate the experiences of racial minority groups within majority school contexts; the challenges that are posed to them within the contexts; the factors that may play a role in their adjustment and functioning within the context; the negotiation of racial-ethnicity and social identity that accompanies it, and the possible relationship that exists between the former and their emotional intelligence (EI). These goals were realised through the launch of a theoretical, as well as an empirical investigation of aforementioned aspects related to the life worlds of racial minority groups in a majority school context. The empirical investigation was conducted from an INTERPRETIVISTIC-positivistic paradigm. Two schools where white and black learners are respectively in the minority were involved in the study. All the learners (grade 9-12) that were regarded as part of the racial minority group in the involved schools, were asked to complete an EI-questionnaire, the EQ-i:YV, after which six participants (three males and three females) from each school were selected on the basis of their scores achieved on the previously mentioned questionnaire. Afterwards qualitative techniques (focus groups, semi-structured interviews, observations and reflection) were implemented to investigate the (racial and social) identity negotiation, adjustment and functioning of the participants in their respective school contexts. The former was also related to their EI. Triangulation and crystallisation were implemented to verify the findings. Racism was identified as the biggest stumbling block to successful integration in the white school context, whereas language appeared to be the biggest stumbling block of the white participants’ adjustment and functioning within their black school context. Social categorisation emerged as a reality in both school contexts and white learners appeared to be evaluated as the higher-status group in both schools. From the results it appears that no relationship worth mentioning exists between the white participants’ EI and their identity negotiation within a black school context, whilst it appears as if a small relationship exists between the black participants’ EI and their identity-negotiation within a white school context. It appears however that a strong relationship exists between participants’ EI and their adjustment and functioning within their majority school context. The following additional factors (that are not applicable to EI) that can play a possible role in the adjustment and functioning of racial minority groups in majority school contexts have also been identified: home circumstances, faith, recognition of sport and/or cultural achievement and the support of one or more parents. AFRIKAANS : Daar is met die wettiging van desegregasie deur die Suid-Afrikaanse Skolewet (Wet no. 84 van 1996) gehoop dat die geleentheid geskep sou word om integrasie tussen leerders te bevorder en dat voorgenoemde na die breër gemeenskap sou uitkring. Uit die media blyk dit egter dat rasse-integrasie in skole allermins positief deur al die rolspelers beleef word en dat die proses nie sonder probleme verloop nie. Die doel van hierdie studie was om ondersoek in te stel na rasseminderheidsgroepe se belewenis van meerderheidskoolkontekste; die uitdagings wat binne hierdie kontekste aan hulle gestel word; die faktore wat moontlik ‘n rol in hulle aanpassing en funksionering in hierdie kontekste speel; die onderhandeling van ras-etniese en sosiale identiteit wat daarmee gepaard gaan, en die moontlike verband wat tussen voorgenoemde en hul emosionele intelligensie (EI) bestaan. Hierdie doelstellings is gerealiseer deur ‘n teoretiese, sowel as ‘n empiriese ondersoek na voorgenoemde aspekte van die leefwêrelde van rasseminderheidsgroepe in meerderheidskoolkontekste te loods. Die empiriese ondersoek is vanuit ‘n INTERPRETIVISTIES-positivistiese paradigma onderneem. Twee skole waar wit en swart leerders onderskeidelik in die minderheid is, is by die studie betrek. Al die leerders (graad 9-12) wat as deel van die rasseminderheidsgroep in die betrokke skole beskou kon word, is gevra om ‘n EI-vraelys, die EQ-i:YV, te voltooi, waarna ses deelnemers (drie seuns en drie dogters) op grond van die tellings wat hulle op voorgenoemde vraelys behaal het, geselekteer is. Kwalitatiewe tegnieke (fokusgroepe, semi-gestruktureerde onderhoudvoering, observasie en refleksie) is daarna geïmplementeer om die (ras-etniese en sosiale) identiteitsonderhandeling, aanpassing en funksionering van die deelnemers in hul onderskeie skoolkontekste te ondersoek. Voorgenoemde is ook met hul EI in verband gebring. Triangulasie en kristallisasie is geïmplementeer om bevindinge te verifieer. Rassisme is as die grootste struikelblok tot suksesvolle integrasie in die wit skoolkonteks geïdentifiseer, terwyl taalprobleme die grootste struikelblok in die wit deelnemers se aanpassing en funksionering in hul swart skoolkonteks blyk te wees. Sosiale kategorisering blyk in albei skoolkontekste ’n realiteit te wees en wit leerders blyk in albei skole as die hoëstatusgroep geëvalueer te word. Uit die resultate blyk dit dat daar geen noemenswaardige verband tussen die wit deelnemers se EI en hulle identiteitsonderhandeling binne ’n swart skoolkonteks bestaan nie, terwyl dit blyk of daar ’n geringe verband tussen die swart deelnemers se EI en hulle identiteitsonderhandeling binne ’n wit skoolkonteks bestaan. Daar blyk egter ’n sterk verband tussen deelnemers se EI en hulle aanpassing en funksionering binne hul meerderheidskoolkontekste te bestaan. Die volgende addisionele faktore (wat nie op EI betrekking het nie) wat moontlik ’n rol in die aanpassing en funksionering van rasseminderheidsgroepe in meerderheidskoolkontekste kan speel, is ook geïdentifiseer: huislike omstandighede, geloof, prestasie op sport en/of kulturele gebied en die ondersteuning van een of meer ouers. Copyright / Thesis (PhD)--University of Pretoria, 2010. / Educational Psychology / unrestricted
|
60 |
’n Ouerbegeleidingsprogram vir ouers van ’n kleuter met gesiggestremdheid (Afrikaans)Vivier, Yolande 16 May 2010 (has links)
AFRIKAANS: Gesinne wat met ’n kleuter met ’n gesiggestremdheid gekonfronteer word, het meervoudige behoeftes wat ’n holistiese benadering vereis ten einde hierdie komplekse probleem effektief aan te spreek. Geen navorsing is egter nog gedoen waar daar na die Suid-Afrikaanse ouer wat ’n kleuter met ’n gesiggestremdheid het, se behoeftes gekyk is ten einde ’n gespesialiseerde, empiries gefundeerde ouerbegeleidingsprogram te ontwikkel nie. Hierdie studie het dus ten doel gehad om ’n begeleidingsprogram vir ouers van ’n kleuter met gesiggestremdheid te ontwikkel en die effektiwiteit daarvan te evalueer. Intervensienavorsing as toegepaste navorsing is hiervoor aangewend.<p[> ’n Tweefase-navorsingsbenadering is gebruik. Tydens fase een is van ’n kwalitatiewe benadering gebruik gemaak. Die volgende navorsingsvraag is tydens hierdie fase geformuleer: Watter behoeftes het die Suid-Afrikaanse ouer van ’n kleuter met gesiggestremdheid? : ’n Fokusgroepbespreking waar fokusgroepvrae benut is, is met 10 ouerpare deurloop ten einde die betekenis en interpretasie wat hulle aan hulle leefwêreld heg, te eksploreer. Hierdie data het, aanvullend tot die omvattende literatuurstudie wat onderneem is, inligting na vore gebring wat in die ouerbegeleidingsprogram gebruik is. Antwoorde op die navorsingsvraag kon dus gevind word. Die kwantitatiewe ontwerp wat tydens fase twee gevolg is, is die enkelstelselontwerp. Die volgende navorsingshipotese is tydens hierdie fase geformuleer: : Indien die ouers van ’n kleuter met gesiggestremdheid die ouerbegeleidingsprogram deurloop, sal hulle bemagtig word met kennis ten opsigte van hulle kind se spesifieke oogtoestand, die invloed daarvan op en hulle hantering van die betrokke kind, hulle huwelik en hulle gesin: . Die maatskaplikewerk-intervensieprogram wat ontwikkel is, bestaan uit ses groepwerksessies van ongeveer 60 minute elk wat met twee groepe van 10 ouers in totaal deurloop is. ’n Selfontwerpte vraelys is voor en na afloop van die program deur al 10 ouers voltooi. Hierdie meetinstrument het bostaande hipotese bevestig. Vergelykings is getref tussen die literatuur en die empiriese gegewens. Gevolgtrekkings en aanbevelings vir toekomstige navorsing is na aanleiding van die studie geformuleer. ENGLISH: Families that are confronted with a toddler with a visual impairment have multiple needs that require a holistic approach in order to address this complex problem effectively. However, no research has been done yet that looks at the needs of the South African parent with a toddler with a visual impairment in order to develop a specialized, empirically grounded parental guiding programme. This study thus aimed at developing a guiding programme for parents with a toddler with a visual impairment and evaluating its effectiveness. Interventional research as applied research was utilised for this purpose. A two-phase research approach was used. During phase one a qualitative approach was used. The following research question was formulated during this phase: What are the needs of the South African parent with a toddler with a visual impairment? A focus-group discussion where focus-group questions were used was held with 10 parents in order to explore the meaning and interpretation that they attach to their daily world. These data, in addition to the wide-ranging literature study that had been undertaken, brought information to the fore that was used in the parental guiding programme. Answers to the research question could thus be found. The quantitative design that was followed during phase two was the single-system design. The following research hypothesis was formulated during this phase: If the parents of a toddler with a visual impairment follow the parental guiding programme, they will be empowered with knowledge with regard to their child’s specific eye condition, its influence on and their management of the child concerned, their marriage and their family. The social-work interventional programme that was developed consists of six group-work sessions of approximately 60 minutes each that were held for two groups of 10 parents in total. A self-designed questionnaire was completed by these 10 parents before and after the programme. This measuring instrument confirmed the above-mentioned hypothesis. Comparisons were made between literature and the empirical data. Conclusions and recommendations for future research were formulated following on this study. / Thesis (DPhil)--University of Pretoria, 2010. / Social Work and Criminology / unrestricted
|
Page generated in 0.1253 seconds