La transformation des produits marins génère d’importantes quantités de rejets. La majorité est transformée pour des applications de masse avec une faible valeur ajoutée. Au Nouveau Brunswick, 85 000 tonnes de produits marins sont transformés annuellement et la moitié est peu ou pas valorisée, c’est le cas de l’holothurie Cucumaria frondosa. Face aux différentes pressions de leur environnement, et notamment la prédation, ces invertébrés marins ont évolué en développant des métabolites d’une large chimiodiversité, ce qui en fait d’excellents candidats pour le développement de substances naturelles bioactives. L’objectif de cette étude a tout d’abord été de chercher à valoriser les coproduits majeurs de Cucumaria frondosa en constituant une large librairie d’extraits et en évaluant, par fractionnement bioguidé, les activités antiherpétiques in vitro des fractions obtenues par différents procédés d’extraction (extractions par solvants et hydrolyses enzymatiques). Nous avons pu mettre en évidence la présence de fractions anti-VHS-1 (Virus Herpes Simplex de type 1). L’hydrolyse enzymatique s’est avérée être une technique efficace pour la génération de substances actives. Le bulbe aquapharyngé peu considéré d’un point de vue industriel représente un réel potentiel pour l’extraction de composés anti-VHS-1, et notamment lorsque celui-ci est hydrolysé par la papaïne en conditions contrôlées. L’activité antiherpétique la plus efficace a été reliée à la présence de molécules à haut poids moléculaires. Dans un second temps, nous avons cherché à comprendre et à mettre en évidence les mécanismes de défense de l’holothurie par l’étude de ces métabolites secondaires relargués en situation de stress. Les métabolites ont été évalués sur différents modèles écotoxicologiques et les molécules actives ont été caractérisées par fractionnement bioguidé par l’utilisation de modèle d’évaluation de cytotoxicité, en parallèle à différents procédés analytiques. L’étude a confirmé l’existence et la production de composés toxiques relargués en situation de stress. Ces métabolites secondaires ont montré une forte toxicité sur différents modèles écotoxicologiques chronique et aiguë. Le fractionnement bioguidé par couplage analytique nous a conduit à l’identification de plusieurs composés du type glycoside triterpénique et notamment le Frondoside A retrouvé dans la fraction responsable de la cytotoxicité. L’étude a permis d’optimiser l’extraction de ce composé d’un intérêt biologique prometteur sans pour autant entraîner la mort de l’animal. / The transformation of marine products generates huge quantities of rejects. The majority of these rejects is used for an upgrading of products with low added value. In New Brunswick, 85 000 tons of marine products are transformed annually, the half is little or not upgraded, that is the case of the holothurian Cucumaria frondosa. Confronted with environmental pressures, and especially predation, the marine invertebrates have evolved and developed various metabolites of different chemical classes. Thus, these metabolites represent ideal candidates for the development of new natural bioactive substances. The objectives of this study was first based on the upgrading of the major byproducts from Cucumaria frondosa by creating a wide library of extracts obtained by different type of extractions (solvent extractions and enzymatic hydrolysis) and then, by bioguided fractionation, evaluating the in vitro anti-HSV-1 (Herpes Simplex Virus, type 1) activities of the fractions. We showed the presence of potent antiherpetic fractions without cytotoxicity on mammalian cells. The enzymatic hydrolysis has been demonstrated to be efficient for the generation of high molecular weight active substances regarding HSV-1. The aquapharyngeal bulb, considered to be less used industrially, represents a real potential for the extraction of anti-HSV-1 compounds, and especially when hydrolyzed by papain under controlled conditions. Secondly, we have searched to understand the mechanism of defense of the holothurian under stress conditions. The secondary metabolites involved were evaluated on different ecotoxicological models. This work has confirmed the existence and the production of toxic compounds released under stress conditions. These secondary metabolites have shown a strong toxicity on acute and chronic ecotoxicological models. The bioguided fractionation assisted by analytical evaluation led to the identification of several triterpene glycosides, and especially the Frondoside A into the cytotoxic fraction. This study has permitted the optimization of the upgrading of the byproducts from Cucumaria frondosa by the extraction of antiherpetic molecules without cytotoxicity and the identification and the characterization of the defense

Dans cette thèse, la biodégradation et le devenir des matières organiques lentement biodégradables contenues dans les eaux usées ont été étudiés. La thèse s’est particulièrement penchée sur l’étude du processus d’hydrolyse dans la mesure où plusieurs auteurs considèrent qu’il s’agit du processus limitant durant la dégradation des matières considérées. L’analyse des résultats de la littérature en complétés de ceux que nous avons obtenu en laboratoire a permis d’identifier et ainsi souligner les manques par rapport aux mécanismes qui régissent la dégradation des matières organiques lentement biodégradables. Ensuite, nous avons confronté ces résultats expérimentaux (expériences réalisées en batch sur des substrats type « particules décantables ») aux modèles conventionnels du traitement des eaux mais aussi à d’autres modèles moins usuels afin d’évaluer les performances de ces derniers à décrire l’hydrolyse des différents substrats. La difficulté de ces modèles à décrire la diversité des situations rencontrées nous a amené à développer un nouveau modèle qui tient compte des propriétés physiques et géométriques du substrat et qui permettrait d’améliorer la caractérisation du processus d’hydrolyse. Enfin, nous nous sommes intéressés à la distinction d’une biomasse hydrolytique dans la masse cellulaire totale et de déterminer son origine. Il a été clairement démontré que l’hydrolyse des PSS dans les procédés à boues activées était plus impactée par les bactéries indigènes, initialement adsorbées dans le réseau, que par les bactéries exogènes, en provenance d’un inoculum de boue activées. / In this work, the fate and biodegradation of slowly biodegradable organic matter contained in wastewaters were investigated. The hydrolysis process was particularly targeted as many sources proved that it controls the fate of the considered substrate. First, a synopsis of the literature results related to this topic as well as internal results were investigated especially in terms of respirometric aspects (OUR measurement) in order to identify differences and/or similarities between the experiments and, thus, address gaps in knowledge of the mechanisms that are involved in the hydrolysis of this matter. Then, in the second part of this thesis, experimental data from batch respirometric tests (performed in our laboratory), involving typical slowly biodegradable matter that are found in wastewaters (e.g. Particulate settleable solids, toilet paper…), were confronted to conventional (IAWQ models) and non-conventional models to evaluate the efficiencies of those models to describe the hydrolysis step. In the third part of this thesis, based on hypotheses, a novel conceptual framework was developed in order to enhance the description of the hydrolysis process. The physical properties (density, size, shape) of the components (bacteria and substrate) were taken into account in this model. Finally, in the fourth and last chapter of this thesis, the specific role of each bacterial population involved in the biodegradation of slowly biodegradable organic matter was assessed. It was here clearly evidenced that the hydrolysis of PSS in activated sludge processes appears more influenced by the initially adsorbed bacteria onto the sewage than by the added AS-inoculum concentration.

Les ligands de type salen constituent la pierre angulaire des travaux décrits dans cette thèse. L’attention particulière portée aux complexes chiraux correspondants est due à leur utilisation comme catalyseurs énantiosélectives versatiles pour promouvoir une large gamme de réactions d’intérêt. Dans le contexte de la catalyse asymétrique hétérogène, nous nous focalisons plus particulièrement sur l’élaboration de catalyseurs polymères cycliques de salens chiraux, appelés complexes calixsalens. Ainsi, nous avons mis au point une voie d’accès directe aux calixsalens de cobalt (III) par polycondensation. Ces complexes testés en tant que catalyseurs dans le dédoublement cinétique dynamique hydrolytique de l’épibromohydrine peuvent être facilement récupérés par simple filtration du milieu réactionnel et réutilisés dans une nouvelle transformation. Ces ligands cycliques permettent donc la préparation de complexes homobimétalliques capables de réaliser une double activation efficace de l’époxyde et de l’eau, conduisant au produit ciblé avec des rendements et des sélectivités élevés.Nous avons également rapporté l’utilisation de ces mêmes calixsalens de cobalt (III) en présences des complexes analogues de manganèse (III) dans la réaction d’hydrolyse des époxydes méso. Ce système de catalyse hétérobimétallique s’est révélé encore plus sélectif que le système homobimétallique impliquant les catalyseurs de cobalt seuls.Suite à ces résultats, nous avons tenté de préparer des complexes de salens hétérobimétalliques, dans lesquels deux métaux différents sont présents sur le même macrocycle. Pour ce faire, nous avons choisi d’explorer la chimie click pour coupler des complexes salens porteurs de différents métaux, modifiés les uns par des fonctions alcynes, les autres par des groupements azotures. / This thesis work takes place in the broad context of salen chemistry. A special attention is given to corresponding chiral complexes used as versatile enantioselective catalysts for a wide range of reactions of interest. In the context of heterogeneous asymmetric catalysis, we focus specifically on the development of polymeric, cyclic, chiral salen catalysts, named calixsalen complexes. Thus, we have developed an easy access to calixsalen cobalt (III) complexes by a facile polycondensation route. These calixsalens were used as catalysts to promote the dynamic hydrolytic kinetic resolution of epibromohydrin. They are easily recovered from the reaction mixture by a simple filtration. These cyclic complexes allowed the formation of homobimetallic species responsible for an efficient dual activation of both the epoxide and water, delivering the targeted product in both high yield and selectivity.We have also reported the use of a combination of cobalt and manganese calixsalen complexes in the hydrolysis of meso epoxydes. This dual heterobimetallic system proved to be even more selective than the homobimetallic one, in which cobalt complexes were only engaged. Based on these results, we have attempted preparing heterobimetallic salen complexes, wherein two different metals should be closely associated into the same macrocycle. Towards this aim, we explored click chemistry to couple alkyne- and azide-functionalized monomeric salen complexes coordinated to two different metals.

Das Ziel der Dissertation ist die Charakterisierung und Optimierung der Prozessbedingungen beim Hochgeschwindigkeitsdrahtflammspritzen. Dazu werden diagnostische Methoden wie das LDA-Verfahren, die Bewertung von Schichten und numerische Betrachtungen herangezogen. Verschiedene Spritzzusatzwerkstoffe wie Massiv- und Fülldrähte sowie hoch- und niedrigschmelzende Materialien werden verarbeitet. Zur Bewertung der Gebrauchseigenschaften erfolgen Korrosions- und Verschleißtests. Aus den Untersuchungsergebnissen resultieren Hinweise und Konzepte zur Verbesserung der Brennertechnik. Die Entwicklung eines neuen HVCW-Systems wird vorgestellt, welches Spritzpartikelgeschwindigkeiten im Überschallbereich ermöglicht, die deutlich über denen klassischer Systeme liegen. In einem gesonderten Abschnitt der Dissertation wird ein neuartiges Verfahren zur Herstellung hydrolysefähigen Materials vorgestellt. Der hergestellte Al-Sn-Werkstoff zersetzt sich in Kontakt mit Wasser unter Abgabe großer Mengen Wasserstoff in kürzester Zeit vollständig.

1. Aufgrund der Resultate mit der Mutante MM10, die trotz Disulfidbrücke noch unverminderte Aktivität und Rotation zeigte, wurde der Frage nachgegangen, ob der EF1-Komplex in der Lage ist, die Rotation durch einen Bruch der alpha-helikalen Struktur von gamma oder durch Rotation um eine Einfachbindung der Disulfidbrücke aufrechtzuerhalten. Quervernetzungen vom Hexagon mit gamma in der Mitte und am unteren Ende konnten das Enzym blockieren. Von den vier betrachteten Mutanten KG11, MM26, MM25 und MM24 fiel der MM26 bereits nach der Isolierung raus. Der MM25 wies nicht mehr als 70% Quervernetzung auf. Bei dem KG11 und dem MM24 konnte jedoch eine 99%-ige Quervernetzung nachgewiesen werden. Mit diesen zwei Cystein-Doppelmutanten wurden weitere Quervernetzungen gefunden, die ebenso wie der MM10 aktiv nach Oxidation sind, aber tiefer im Enzym liegen und die ATP-Hydrolyse trotz Blockade durch Quervernetzung aufrecht erhalten. Es konnte gezeigt werden, dass eine Rotation um die Einzelbindungen innerhalb der Disulfidbrücke unwahrscheinlich ist, und daher die Aktivität des quervernetzten Enzyms nur durch eine Aufwindung der gamma-Helix erklärt werden kann. 2. Die Voraussetzung für ein EFOF1-Kostrukt zum optischen Nachweis der Relativrotation unter Synthesebedingungen war der Einbau von zwei verschiedenen Tags zur spezifischen Bindung. Von den vier Mutanten SE3, SE4, SW7 und WH1 zeigten die beiden SE-Mutanten keine Stabilität bei der Isolierung im Bezug auf die Kopplung zwischen FO- und F1-Teil. Mit dem SW7-EFOF1 wurde eine Mutante gefunden, die mit einer guten Aktivitäts- und Rotationsausbeute nach einer Aufreinigung mittels Streptactin-Affinitätchromatographie durch ihre Stabilität als Ausgangspunkt für das Rotationsexperiment unter ATP-Synthese dienen kann. Der WH1, dessen atp-Operon dem des SW7 gleicht, brachte trotz seines veränderten Vektorursprungs keine Verbesserung.

Cette thèse porte sur les réactions abiotiques catalysées par un acide dans les systèmes biologiques. Elles sont définis comme des systèmes réactionnels composés d'un substrat xénobiotique - un acétal cyclique dans ce travail - stable dans des conditions biologiques et clivable à un pH bas et d'un catalyseur acide hétérogène correspondant biocompatible. Le défi de cette approche est de maintenir le catalyseur actif dans un milieu biologique tamponné et toujours capable d'hydrolyser le substrat xénobiotique d'acétal et de maintenir le pH tamponné du système vivant dans son état d'origine. Dans la première partie de ce travail, nous nous concentrons sur le réglage précis des acétals cycliques. Nous identifions 4 structures acétales et montrons que les changements structurels conduisent à une réactivité différente dans différentes gammes de pH, chacune correspondant à des applications possibles in vivo, notamment des lieurs stables pour les conjugués anticorps-médicaments et des lieurs clivables dans des conditions physiologiques pour la bioconjugaison.La deuxième partie est axée sur le catalyseur biocompatible. Ici, nous identifions deux catalyseurs biocompatibles solides, ayant différents degrés d'hydrophobie et de propriétés d’adsorption : le copolymère Nafion NR-50 et le copolymère PEG-AASA. Nous démontrons qu’avec un traitement approprié, ils peuvent maintenir un pH interne inférieur à 4, hydrolyser le substrat et ne pas affecter le biofluide hautement tamponné utilisé comme solvant. / This thesis object is acid-catalysed abiotic reactions in biological systems. They are defined as reaction systems composed by a xenobiotic substrate – a cyclic acetal in this work - stable in biological conditions and cleavable at low pH and a corresponding biocompatible heterogeneous acid catalyst. The challenge of this approach is to keep the catalyst active in a buffered biological media and still capable of hydrolysing the xenobiotic acetal substrate and to maintain the buffered pH of the living system in its original state. In the first part of this work we focus on the fine-tuning of cyclic acetals. We identify 4 acetal structures and we show that structural changes lead to a different reactivity in different pH ranges, each corresponding to possible applications in vivo, including stable linkers for antibody drug conjugates and linkers cleavable in physiological conditions for bioconjugation.The second part is focused on the biocompatible catalyst. Herein we identify two solid biocompatible catalysts, with different degree of hydrophobicity and adsorbance properties: Nafion NR-50 and PEG-AASA co-polymer. We demonstrate that, upon proper treatment, they can maintain an inner pH < 4, hydrolyse the substrate and do not affect the highly buffered biofluid used as solvent.

Valorisation of side-streams in food production has become an important booster for increased sustainability in food production. The objective of this work was to study and improve the functional properties of green coffee (GC) protein. Extraction of defatted GC meal by using PVPP slightly increased protein yield and significantly decreased the amount of covalently and non-covalently bound CQA, therefore decreasing the antioxidant activity of the meal. Peptic hydrolysis at pH 1.5 led to a significantly higher degree of hydrolysis (DH) than at pH 3. Sodium dodecylsulfate polyacrylamide gel electrophoresis (SDS-PAGE) showed that the molecular weights of peptides of GC protein hydrolysates were in the range of 11–60 kDa, while peptides were in the range of 500–5000 Da using matrix-assisted laser desorption/ionization-time of flight mass spectroscopy (MALDI-TOF MS). Additionally, the enzymatic hydrolysis significantly improved the antioxidant activity of the GC protein. Finally, the results suggest that enzymatic hydrolysis with pepsin is an effective technique to provide bioactive compounds. The works presented in our manuscript may help in further exploiting the potential use of green coffee beans for food, cosmetic or pharmaceutical industry.

In der vorliegenden Arbeit werden Möglichkeiten der Stabilisierung und die photokatalytische Aktivität von Polymorphen des Bismut(III)-oxids, synthetisiert ausgehend von nanoskaligen, polynuklearen Bismutoxidoclustern, beschrieben. Hydrolyse- und Kondensationsstudien werden mit dem Ziel der Aufklärung von Bildungsprozessen von Bismutoxidoclustern ausgehend von bismutnitrat- und bismutsilanolathaltigen Lösungen durchgeführt. Basierend auf polynuklearen Modellverbindungen wird durch deren Hydrolyse und anschließende thermische Behandlung die Darstellung von Nanopartikeln von verschiedenen Polymorphen des Bismut(III)-oxids erreicht. Die Reaktivität der synthetisierten β Bi2O3 Nanopartikel wird zur Synthese von Verbindungen vom Sillenit-Strukturtyp ausgenutzt. Diese Verbindungen sind isostrukturell zum metastabilen γ-Bi2O3. Die isolierten oxidischen Materialien weisen eine hohe photokatalytische Aktivität gegenüber wässrigen Rhodamin B Lösungen bei der Bestrahlung mit sichtbarem Licht auf. Für die β Bi2O3 Nanopartikel wird ebenso die photokatalytische Aktivität gegenüber wässrigen Farbstofflösungen von Indigokarmin, Orange G, Methylorange und Methylenblau sowie wässrigen Schadstofflösungen von Phenol, 4-Chlorphenol, 2,4-Dichlorphenol, 4-Nitrophenol, Triclosan und Ethinylestradiol beschrieben. Die Charakterisierung der synthetisierten Verbindungen erfolgte unter anderem mittels Einkristall-Röntgenstrukturanalyse, Röntgenpulverdiffraktometrie, NMR-Spektroskopie, FTICR-ESI-Massenspektrometrie, UV/Vis-, Infrarot- und Ramanspektroskopie sowie thermischen Analysemethoden. / The present essay describes the stabilization and photocatalytic activity of different polymorphs of bismuth(III) oxide which were prepared starting from nanoscaled, polynuclear bismuth oxido clusters. Hydrolysis and condensation processes of bismuth nitrate as well as bismuth silanolates in solution were performed to provide an insight into the formation process of bismuth oxido clusters. Nanoparticles of different polymorphs of bismuth(III) oxide were obtained by hydrolysis, followed by annealing steps at temperatures of 370 °C and 600 °C starting from polynuclear bismuth compounds, respectively. The high reactivity of the as-prepared β-Bi2O3 nanoparticles was used to synthesize sillenite-type compounds at rather low temperatures which are isostructural to metastable γ-Bi2O3. The isolated oxidic materials show promising photocatalytic activities exemplified by the degradation of aqueous Rhodamine B solutions under visible light irradiation. Additionally, the β- Bi2O3 nanoparticles were tested in photodegradation processes of aqueous solutions containing different dyes such as indigo carmine, orange G, methyl orange and methylene blue as well as typical organic pollutants such as phenol, 4-chlorophenol, 2,4-dichlorophenol, 4-nitrophenol, triclosan and ethinyl estradiol. The characterization of the as-prepared materials was performed using single crystal X-ray diffraction, powder X-ray diffraction analysis, NMR spectroscopy, FTICR- electrospray ionization mass spectrometry, UV/Vis-, IR- and Raman spectroscopy, electron microscopy, nitrogen physisorption as well as thermal analyses.

In der vorliegenden Arbeit wird die Synthese neuartiger, polynuklearer Bismutoxido-Cluster sowie deren Potential zur Verwendung als Bausteine zum Aufbau organisch-anorganischer Hybridmaterialien beschrieben. Die molekularen Verbindungen werden nach partieller Hydrolyse eines basischen Bismutnitrats in DMSO erhalten. Durch Zugabe von Additiven wie Carbon- und Sulfonsäuren können funktionalisierte Bismutoxido-Cluster erzeugt werden, die eine gute Löslichkeit in organischen polaren Lösungsmitteln besitzen. Die Charakterisierung der Produkte erfolgte mittels Einkristallröntgenstrukturanalyse, NMR- und IR-Spektroskopie sowie ESI-Massenspektrometrie. Erste Untersuchungen zur Synthese röntgenopaker organisch-anorganischer Hybridmaterialien auf der Basis von Bismutoxido-Clustern und Methylmethacrylat wurden durchgeführt. Hierzu wurde der nanoskalige Bismutoxido-Cluster [Bi38O45(OMc)24] als anorganischer Baustein gewählt. Die Oberfläche des Bismut-Sauerstoff-Gerüsts dieser Verbindung ist mit Methacrylat-Liganden bedeckt, welche eine gute Löslichkeit vermitteln und durch ihre polymerisierbaren Funktionalitäten eine kovalente Anbindung z. B. an Vinylmonomere ermöglichen. Die radikalische Copolymerisation von [Bi38O45(OMc)24] mit Methylmethacrylat liefert transparente Komposite, die anhand von Festkörper-NMR-Spektroskopie, IR-Spektroskopie sowie TG- und DSC-Analyse charakterisiert wurden.

In der vorliegenden Arbeit werden Möglichkeiten der Stabilisierung und die photokatalytische Aktivität von Polymorphen des Bismut(III)-oxids, synthetisiert ausgehend von nanoskaligen, polynuklearen Bismutoxidoclustern, beschrieben. Hydrolyse- und Kondensationsstudien werden mit dem Ziel der Aufklärung von Bildungsprozessen von Bismutoxidoclustern ausgehend von bismutnitrat- und bismutsilanolathaltigen Lösungen durchgeführt. Basierend auf polynuklearen Modellverbindungen wird durch deren Hydrolyse und anschließende thermische Behandlung die Darstellung von Nanopartikeln von verschiedenen Polymorphen des Bismut(III)-oxids erreicht. Die Reaktivität der synthetisierten β Bi2O3 Nanopartikel wird zur Synthese von Verbindungen vom Sillenit-Strukturtyp ausgenutzt. Diese Verbindungen sind isostrukturell zum metastabilen γ-Bi2O3. Die isolierten oxidischen Materialien weisen eine hohe photokatalytische Aktivität gegenüber wässrigen Rhodamin B Lösungen bei der Bestrahlung mit sichtbarem Licht auf. Für die β Bi2O3 Nanopartikel wird ebenso die photokatalytische Aktivität gegenüber wässrigen Farbstofflösungen von Indigokarmin, Orange G, Methylorange und Methylenblau sowie wässrigen Schadstofflösungen von Phenol, 4-Chlorphenol, 2,4-Dichlorphenol, 4-Nitrophenol, Triclosan und Ethinylestradiol beschrieben. Die Charakterisierung der synthetisierten Verbindungen erfolgte unter anderem mittels Einkristall-Röntgenstrukturanalyse, Röntgenpulverdiffraktometrie, NMR-Spektroskopie, FTICR-ESI-Massenspektrometrie, UV/Vis-, Infrarot- und Ramanspektroskopie sowie thermischen Analysemethoden.:Verzeichnis der verwendeten Abkürzungen ix 1 Einleitung und Problemstellung 1 1.1 Motivation 2 1.2 Das weltweite Wasserproblem 3 1.3 Bismuthaltige Verbindungen als Ausgangsstoffe für eine „grüne“ Zukunft 8 1.4 Konzept zur Durchführung der vorliegenden Untersuchungen 11 2 Bismutoxidocluster 13 2.1 Der Weg von bismuthaltigen Lösungen zu Bismutoxidoclustern 14 2.2 Untersuchungen zum Reaktionsverhalten von Bismut(III)-nitrat in Lösung 22 2.2.1 Kristallisation von [Bi6O4(OH)4(NO3)6(H2O)2]•H2O (1) 22 2.2.2 Kristallisation von [{Bi38O45(NO3)24(DMSO)26}•2DMSO] [{Bi38O45(NO3)24(DMSO)24}•0.5DMSO] ([2a][2b]) 32 2.2.3 Umsetzungen von [Bi22O26(OSiMe2tBu)14] mit Methylsalicylsäuren und Kristallisation von [Bi38O45(HSal4Me)24(DMSO)13.2]•6H2O (3) 43 2.2.4 Kristallisation von [Bi38O45(HSal)22(OMc)2(DMSO)15(H2O)] •DMSO∙2H2O (4) 58 2.2.5 Kristallisation von [Bi(C18H14P(O)SO3)2(DMSO)3](NO3)•DMSO∙2H2O (5) 64 3 Bismut(III)-oxide 71 3.1 Grundlagen 72 3.1.1 Der ausgeprägte Polymorphismus von Bi2O3 und dessen Auswirkungen 72 3.1.2 Strukturelle Betrachtungen der einzelnen Bi2O3-Polymorphe 78 3.1.3 Strukturelle Beziehungen zwischen den Bismutoxidpolymorphen 84 3.2 Hydrolyse von Bismutoxidoclustern 86 3.2.1 Stabilisierung von β-Bi2O3 89 3.2.2 Stabilisierung von „γ-Bi2O3“ sowie von Verbindungen vom Sillenit-Strukturtyp 114 3.2.3 Stabilisierung von δ-Bi2O3 126 4 Photokatalytische Untersuchungen an Bismut(III)-oxiden 135 4.1 Grundlagen der Photokatalyse mit Halbleitern 136 4.1.1 Historische Entwicklungen und potentielle Anwendungen 136 4.1.2 Definition von Begriffen und Anforderungen im Bereich der Photokatalyse 139 4.1.3 Mechanismen der photokatalytischen Aktivität für den Abbau von Schadstoffen 141 4.1.4 Eigenschaften und Charakteristika von Halbleiter-Photokatalysatoren 143 4.1.5 Zersetzung von Rhodamin B und deren Kinetik als Beispiel für photokatalytische Abbaureaktionen 147 4.2 Ergebnisse und Diskussion 151 4.2.1 Untersuchungen zur photokatalytischen Aktivität von β-Bi2O3 153 4.2.2 Untersuchungen zur photokatalytischen Aktivität von „γ-Bi2O3“ bzw. von Verbindungen vom Sillenit-Strukturtyp 176 4.2.3 Untersuchungen zur photokatalytischen Aktivität von δ-Bi2O3 179 4.2.4 Zusammenfassung der photokatalytischen Untersuchungen 181 5 Zusammenfassung und Ausblick 182 6 Experimenteller Teil 193 6.1 Arbeitstechniken und verwendete Geräte 194 6.2 Synthese der Bismutoxidocluster 198 6.2.1 Synthese von [Bi6O4(OH)4(NO3)6(H2O)2]∙H2O (1) 198 6.2.2 Synthese von [{Bi38O45(NO3)24(DMSO)26}•2DMSO] [{Bi38O45(NO3)24(DMSO)24}•0.5DMSO] ([2a][2b]) 198 6.2.3 Synthese von [Bi22O26(HSalxMe)14] und Kristallisation von [Bi38O45(HSal4Me)24(DMSO)13.2]•6H2O (3) 199 6.2.4 Synthese von [Bi38O45(HSal)22(OMc)2(DMSO)15(H2O)]•DMSO∙2H2O (4) 201 6.2.5 Synthese von [Bi(C18H14P(O)SO3)2(DMSO)3](NO3)•DMSO∙2H2O (5) 202 6.3 Synthese der Bismut(III)-oxide 202 6.3.1 Synthese von β-Bi2O3 202 6.3.2 Synthese von Verbindungen vom Sillenit-Strukturtyp 208 6.3.3 Stabilisierung von δ-Bi2O3 209 6.4 Photokatalytische Untersuchungen 210 7 Literaturverzeichnis 211 8 Anhang 236 8.1 Abbildungen und Tabellen 237 8.2 Kristallographische Daten 247 8.3 Ausgewählte Veröffentlichungen 249 Curriculum Vitae 254 Publikationsverzeichnis 255 Tagungsbeiträge 257 / The present essay describes the stabilization and photocatalytic activity of different polymorphs of bismuth(III) oxide which were prepared starting from nanoscaled, polynuclear bismuth oxido clusters. Hydrolysis and condensation processes of bismuth nitrate as well as bismuth silanolates in solution were performed to provide an insight into the formation process of bismuth oxido clusters. Nanoparticles of different polymorphs of bismuth(III) oxide were obtained by hydrolysis, followed by annealing steps at temperatures of 370 °C and 600 °C starting from polynuclear bismuth compounds, respectively. The high reactivity of the as-prepared β-Bi2O3 nanoparticles was used to synthesize sillenite-type compounds at rather low temperatures which are isostructural to metastable γ-Bi2O3. The isolated oxidic materials show promising photocatalytic activities exemplified by the degradation of aqueous Rhodamine B solutions under visible light irradiation. Additionally, the β- Bi2O3 nanoparticles were tested in photodegradation processes of aqueous solutions containing different dyes such as indigo carmine, orange G, methyl orange and methylene blue as well as typical organic pollutants such as phenol, 4-chlorophenol, 2,4-dichlorophenol, 4-nitrophenol, triclosan and ethinyl estradiol. The characterization of the as-prepared materials was performed using single crystal X-ray diffraction, powder X-ray diffraction analysis, NMR spectroscopy, FTICR- electrospray ionization mass spectrometry, UV/Vis-, IR- and Raman spectroscopy, electron microscopy, nitrogen physisorption as well as thermal analyses.:Verzeichnis der verwendeten Abkürzungen ix 1 Einleitung und Problemstellung 1 1.1 Motivation 2 1.2 Das weltweite Wasserproblem 3 1.3 Bismuthaltige Verbindungen als Ausgangsstoffe für eine „grüne“ Zukunft 8 1.4 Konzept zur Durchführung der vorliegenden Untersuchungen 11 2 Bismutoxidocluster 13 2.1 Der Weg von bismuthaltigen Lösungen zu Bismutoxidoclustern 14 2.2 Untersuchungen zum Reaktionsverhalten von Bismut(III)-nitrat in Lösung 22 2.2.1 Kristallisation von [Bi6O4(OH)4(NO3)6(H2O)2]•H2O (1) 22 2.2.2 Kristallisation von [{Bi38O45(NO3)24(DMSO)26}•2DMSO] [{Bi38O45(NO3)24(DMSO)24}•0.5DMSO] ([2a][2b]) 32 2.2.3 Umsetzungen von [Bi22O26(OSiMe2tBu)14] mit Methylsalicylsäuren und Kristallisation von [Bi38O45(HSal4Me)24(DMSO)13.2]•6H2O (3) 43 2.2.4 Kristallisation von [Bi38O45(HSal)22(OMc)2(DMSO)15(H2O)] •DMSO∙2H2O (4) 58 2.2.5 Kristallisation von [Bi(C18H14P(O)SO3)2(DMSO)3](NO3)•DMSO∙2H2O (5) 64 3 Bismut(III)-oxide 71 3.1 Grundlagen 72 3.1.1 Der ausgeprägte Polymorphismus von Bi2O3 und dessen Auswirkungen 72 3.1.2 Strukturelle Betrachtungen der einzelnen Bi2O3-Polymorphe 78 3.1.3 Strukturelle Beziehungen zwischen den Bismutoxidpolymorphen 84 3.2 Hydrolyse von Bismutoxidoclustern 86 3.2.1 Stabilisierung von β-Bi2O3 89 3.2.2 Stabilisierung von „γ-Bi2O3“ sowie von Verbindungen vom Sillenit-Strukturtyp 114 3.2.3 Stabilisierung von δ-Bi2O3 126 4 Photokatalytische Untersuchungen an Bismut(III)-oxiden 135 4.1 Grundlagen der Photokatalyse mit Halbleitern 136 4.1.1 Historische Entwicklungen und potentielle Anwendungen 136 4.1.2 Definition von Begriffen und Anforderungen im Bereich der Photokatalyse 139 4.1.3 Mechanismen der photokatalytischen Aktivität für den Abbau von Schadstoffen 141 4.1.4 Eigenschaften und Charakteristika von Halbleiter-Photokatalysatoren 143 4.1.5 Zersetzung von Rhodamin B und deren Kinetik als Beispiel für photokatalytische Abbaureaktionen 147 4.2 Ergebnisse und Diskussion 151 4.2.1 Untersuchungen zur photokatalytischen Aktivität von β-Bi2O3 153 4.2.2 Untersuchungen zur photokatalytischen Aktivität von „γ-Bi2O3“ bzw. von Verbindungen vom Sillenit-Strukturtyp 176 4.2.3 Untersuchungen zur photokatalytischen Aktivität von δ-Bi2O3 179 4.2.4 Zusammenfassung der photokatalytischen Untersuchungen 181 5 Zusammenfassung und Ausblick 182 6 Experimenteller Teil 193 6.1 Arbeitstechniken und verwendete Geräte 194 6.2 Synthese der Bismutoxidocluster 198 6.2.1 Synthese von [Bi6O4(OH)4(NO3)6(H2O)2]∙H2O (1) 198 6.2.2 Synthese von [{Bi38O45(NO3)24(DMSO)26}•2DMSO] [{Bi38O45(NO3)24(DMSO)24}•0.5DMSO] ([2a][2b]) 198 6.2.3 Synthese von [Bi22O26(HSalxMe)14] und Kristallisation von [Bi38O45(HSal4Me)24(DMSO)13.2]•6H2O (3) 199 6.2.4 Synthese von [Bi38O45(HSal)22(OMc)2(DMSO)15(H2O)]•DMSO∙2H2O (4) 201 6.2.5 Synthese von [Bi(C18H14P(O)SO3)2(DMSO)3](NO3)•DMSO∙2H2O (5) 202 6.3 Synthese der Bismut(III)-oxide 202 6.3.1 Synthese von β-Bi2O3 202 6.3.2 Synthese von Verbindungen vom Sillenit-Strukturtyp 208 6.3.3 Stabilisierung von δ-Bi2O3 209 6.4 Photokatalytische Untersuchungen 210 7 Literaturverzeichnis 211 8 Anhang 236 8.1 Abbildungen und Tabellen 237 8.2 Kristallographische Daten 247 8.3 Ausgewählte Veröffentlichungen 249 Curriculum Vitae 254 Publikationsverzeichnis 255 Tagungsbeiträge 257