Die vorliegende Dissertation behandelt die Synthese und Charakterisierung neuartiger hetero- und homoleptischer Carboxylato- und Sulfonatobismut(III)verbindungen, die Potential für antimikrobielle Anwendungen und/oder als Präkursoren für röntgenopake organisch-anorganische Hybridmaterialien aufweisen. Als Ausgangsstoffe dienten Arylbismutane, deren supramolekulare Strukturen in Abhängigkeit der funktionellen Gruppe am organischen Substituenten mit dem Ziel der Analyse intermolekularer Metall∙∙∙π(Aryl)-Wechselwirkungen sowie deren Einfluss auf die Ausbildung von Polymorphen diskutiert werden. Die Einstellung der Reaktionsbedingungen bei den Umsetzungen dieser Organobismutverbindungen mit Carbon- oder Sulfonsäuren erlaubt die gezielte Synthese carboxylato- oder sulfonatosubstituierter Koordinationspolymere des Bismuts unter milden Bedingungen. Neben der Beschreibung der Strukturen wird das Verhalten dieser Verbindungen in Lösung besprochen. Zur Aufklärung der Bildungsmechanismen von Bismutoxidoclustern wurden Hydrolyse- und Kondensationsstudien ausgehend von Lösungen der Bismutcarboxylate und -sulfonate sowie polynuklearer Modellverbindungen durchgeführt. Die in diesem Verlauf isolierten, funktionalisierten Bismutoxidospezies vertiefen die Erkenntnisse zum strukturellen Aufbau sowie zum Reaktionsverhalten der nanoskaligen Moleküle. Dabei werden u. a. die Symmetrieelemente der Bismutoxidocluster sowie Clusterabbaureaktionen beschrieben. Die Charakterisierung der synthetisierten Verbindungen erfolgte mittels Einkristallröntgenstrukturanalyse, Pulverröntgendiffraktometrie, Infrarot- und Kernspinresonanzspektroskopie sowie thermischen Analysemethoden.

Les fibres d'acide polylactique (PLA), issues de ressources agricoles renouvelables, ont suscité à leur apparition un grand intérêt car il s'agit de fibres ayant les avantages des fibres synthétiques. Or très vite des inconvénients sont apparus en particulier lors de leur teinture : elles se saturent très facilement conduisant a des nuances pastel et les solidités aux lavages des teintures sont médiocres. Nous avons vérifié que la cristallinité des fibres de PLA est du même ordre de grandeur que celle du polyester classique (55- au pire 60%). Par contre les traitements aqueux type teinture font croître cette cristallinité, peut-être par hydrolyse des zones amorphes. Mais la teinture est très rapide, ce qui signifierait que les zones amorphes sont à peine orientées ce qui est confirmé par RX (un fond continu vraiment plat) et de ce fait elles ne retiennent pas le colorant. Les isothermes d'adsorption montrent également qu'il n'y a pas d'adsorption mais " solution " puisqu'elles sont de type Nernst et que la fixation de colorant décroît avec la croissance de la température. En plus, à chaque traitement aqueux de la fibre est hydrolysée ce qui entraîne une perte de colorant et une réduction lente des propriétés mécaniques de la fibre. Ce dernier phénomène étant relativement long d'où nous avons formulé une hypothèse que l'hydrolyse des bouts de chaine serait plus rapide que celle des milieux de chaine.

L'élaboration de squelettes de pipéridinones et lactones a été accomplie de manière très efficace en alliant processus radicalaires et ioniques. La synthèse d'oximes SEM-protégées par un assemblage multicomposant radicalaire permet, après hydrolyse de la fonction oxime, d'obtenir rapidement un aldéhyde fonctionnalisé. Ce composé est ensuite transformé en lactone ou pipéridinone désirée par un processus ionique.Une approche minimisant le nombre d'étapes élémentaires a été développée autorisant ainsi un accès rapide et convenable à une grande diversité de structures. Ces processus peuvent impliquer jusqu'à cinq composants. / The construction of piperidinone and lactone scaffolds has been performed efficiently, combining radical and ionic processes. The synthesis of SEM-protected oximes by a multicomponent radical reaction enables, after hydrolysis of the oxime functional group, the access to a functionalized aldehyde. This compound is then converted into a lactone or a piperidinone by a ionic process.An approach minimizing the number of steps has been developed, thus allowing a rapid and convenient access to a large diversity of structures. These processes may involve up to five components.

Die Verfügbarkeit von Metallen in der Geo- und Biosphäre wird durch deren chemische Form, die Speziation, bestimmt. Zur Analyse der Speziation gibt es eine Vielzahl von Techniken. Für spektroskopische Methoden sind untersuchbare Konzentrationsbereiche unter anderem durch entsprechende Detektionsgrenzen eingeschränkt. Vor allem für niedrige Konzentrationen (< 10 µM), wie sie für viele natürliche Systeme von Bedeutung sind, ist die Lumineszenzspektroskopie ein geeignetes Werkzeug. Die Zerlegung spektroskopischer Daten von komplexen Systemen stellt eine zusätzliche Herausforderung dar. Zur Extraktion spektraler Informationen individueller chemischer Spezies werden moderne mathematische Verfahren verwendet. Die so erhaltene spektroskopische Charakterisierung kann zur strukturellen und thermodynamischen Interpretation genutzt werden. In dieser Arbeit wurde die parallele Faktoranalyse (PARAFAC) zur Auswertung spektroskopischer Datensätze genutzt. Diese Technik wurde hier erstmals auf Uranyl(VI)-Systeme angewendet, wodurch eine umfassende lumineszenzspektroskopische Charakterisierung der Uranyl(VI)-Hydrolyse generiert wurde. Zusätzlich wurde der bestehende PARAFAC-Algorithmus (N-way Toolbox) erweitert. Damit wird die Zerlegung auf chemisch interpretierbare Ergebnisse beschränkt und eine direkte Extraktion thermodynamischer Daten ermöglicht. Für die mononuklearen Hydrolysespezies konnten korrigierte Komplexstabilitätskonstanten vorgeschlagen werden, wodurch entsprechende Speziationsrechnungen belastbarer werden. Die extrahierten spektralen Eigenschaften einzelner Spezies wurden anschließend sorgfältig analysiert. Dazu wurden quantenmechanische sowie semiempirische Ansätze genutzt. Neben einerValidierung der angenommenen Speziesbezeichnung wurde dadurch erstmals eine fundierte lumineszenzspektroskopische Signal-Struktur-Beziehung für die Uranyl(VI)-Hydrolyse generiert. Die entwickelten Algorithmen wurden im Rahmen der Arbeit auf komplexere Systeme des Uranyl(VI) und Europium(III) übertragen und deren Gültigkeit nachgewiesen. So konnten neue Erkenntnisse zur Lumineszenzlöschung des Uranyl(VI)-Ions und der Europium(III)-Hydrolyse gewonnen werden. Zudem wurde eine Strategie zur einfachen und akkuraten Bestimmung der Anzahl von Bindungsstellen am Beispiel des Proteins Calmodulin vorgestellt. Der aufgezeigte breite Anwendungsbereich wird zusätzlich durch die erfolgreiche Übertragung der SpecConst-Erweiterung auf andere spektroskopische Techniken (am Beispiel der UV-vis Spektroskopie) erweitert. Die vorgestellten Werkzeuge verbessern die Auswertung spektroskopischer Daten und erweitern das damit verbundene Verständnis komplexer umweltrelevanter Systeme.

L'état actuel de l'art lié à la technologie de conversion de la biomasse a, jusqu'à présent,principalement concerné les méthodes enzymatiques, éventuellement couplées à des prétraitements thermomécaniques ; les biomasses concernées sont généralement riches en cellulose, mais le matériel à haute teneur en amidon brut est également important des deux points stratégique et économique. Notre nouvelle stratégie est une contribution à l’étude de ce dernier type de biomasses riches en amidon, en vue d’une conversion comportant une seule étape de transformation en oligosaccharide et en glucose, à l’aide de la technologie thermo-mécanique de Détente Instantanée Contrôlée DIC. Cette opération a été étudiée,analysée, modélisée et optimisée. Contrairement à un traitement thermique conventionnel,la technologie DIC comporte deux étapes incluant l’instauration d’un vide capable d'accroître l'accessibilité de la vapeur dans la biomasse, puis d’une étape de vide final en vue de réduire la génération de molécules de dégradation thermique du glucose. L’analyse des composés (oligosaccharides, glucose…) a été réalisée ; elle a pu démontrer que le process était étroitement associée à la sévérité du traitement brut. Le prétraitement DIC de faible sévérité mène à des rendements élevés en fractions oligo saccharidiques avec une petite fraction de glucose. Par contre, le traitement DIC de haute sévérité permet d’accéder au glucose comme principal produit final. Au cours de l'étude exploratoire, le cycle de vide et de haute pression d'humidité a été établi, avec comme facteur de réponse le taux de conversion de l'amidon en glucose brut. Les deux facteurs de pression de vapeur d’eau et de vide ont été combinés ensemble afin d'optimiser trois autres facteurs opératoires : la concentration d'acide, le couple de pression/température et le temps de traitement. Le traitement DIC de haute sévérité a été démontré comme étant capable de convertir près de50% d'amidon brut en glucose à l'étape du simple et unique traitement thermomécanique.Une autre étape du processus a été impliquée : il s’agit de l'hydrolyse à l’acide dilué, souvent à la suite du prétraitement DIC. Au cours de l’étape d'optimisation du prétraitement DIC, la méthodologie de surface de réponse a été utilisée pour aider au développement de modèles cinétiques auto-hydrolysés DIC. D'autre part, les modèles empiriques de la cinétique ont été développés. Dans le cas de faible sévérité, le modèle aboutit à des réponses étroitement associées aux deux limites inférieures et supérieures de la concentration acide et du temps de traitement. Par contre, ces modèles quand ils sont obtenus à de niveaux de traitement grande sévérité, ont été jugés seulement associés aux valeurs supérieures de ces paramètres opératoires. Cette observation a été déduite de l’équation polynomiale utilisée, tandis que les modèles cinétiques ont été basés sur une série exponentielle. Une série polynomiale de plus grand ordre serait donc nécessaire pour pouvoir explorer avec précision les données de la surface de réponse pour ce genre d'analyse approfondie à tous les niveaux des facteurs.Lors de l'étape d'optimisation de l’hydrolyse dans une solution d'acide dilué, le premier modèle cinétique consécutive a été développé pour étudier les mécanismes de conversion des polysaccharides totale en glucose et en ses produits de dégradation. Le modèle empirique de surface de réponse a été utilisé pour étudier les effets de facteurs pendant le processus opératoire. La teneur en humidité et le cycle de vide ont été des facteurs communs. Plus le temps de traitement est court et plus la température est élevée, et plus la génération du glucose est importante. Cette étude montre que le traitement DIC de haute sévérité est capable de convertir les polysaccharides totaux en glucose avec une faible dégradation du glucose. Les produits solides résiduels pourraient également faire l’objet d'un traitement enzymatique. / Present state of art related to biomass conversion technology so far was found to concentrate on an enzymatic process, coupled with thermal pretreatment on biomass rich in cellulose. Biomass that rich in crude starch is also important in terms of strategic and economic point of view. The main objective of this study is to adopt a new strategy for a single step conversion of a crude starch material into oligosaccharide and glucose utilizing DIC technology. In contrast to existing thermal based pretreatment, DIC technology involves two vacuum cycles; first vacuum cycle was to increase steam accessibility on biomass and to reduce generation of steam condensate thus avoid losing of monosaccharide and hemicelluloses, while second vacuum cycle was to reduce potential thermal degradation of glucose. Distributions of products formed were found to be closely associated with severity of treatment on crude starch material. At lower DIC severity, pretreatment favors the formations of high oligosaccharide composition with small fraction of glucose; while at high DIC severity, pretreatment favors formation of high glucose as a major end product. During an exploratory study to establish the relevant reaction factors; vacuum cycle and moisture content were the two main factors influencing the conversion of crude starch into glucose.DIC starch conversion into glucose was found to be moisture dependent. Both factors were combined together to optimize the other three factors: pressure/temperature, treatment times, and acid concentration. High DIC severity treatment alone could convert nearly 50% of crude starch into glucose. During DIC optimization, an experimental design was developed and tested with DIC pretreatment in order to obtain a second order polynomial mathematical model that was then applied for response surface methodology (RSM). The interaction nature of above factors was examined and was found they depend on DIC treatment severity. Two experimental designs with low and high DIC severity were developed; Low DIC severity (acid: 0.01-0.05 molar, time: 0.5-3.0 min) and High DIC severity (acid: 0.05-0.20 molar, time: 3.0-10.0 min) with similar temperature range (144-165oC) were used. Data mining operation was done on RSM model to develop a kinetic model at both treatment severities. Kinetic data, including rate constant and activation energy were calculated from kinetic models of both severities to compare with actual dilute acidhydrolysis kinetic studies on two DIC treated samples. It was found that activation energy (Ea)for glucose generation at High DIC severity (Ea: 59.44 kJ/mol) was lower than at optimum dilute acid hydrolysis (Ea: 91.30 kJ/mol); while for glucose degradation, Ea was higher with High DIC severity (Ea: 144.12 kJ/mol) if compared to dilute acid hydrolysis (Ea: 45.14 kJ/mol).This indicates that glucose generation with DIC requires less energy while its degradation needs high energy. This combination was required to maximize glucose generation and minimize glucose degradation. Further studies with non-isothermal state during DIC and dilute acid hydrolysis support this finding. In normal polysaccharide conversion to low molecular weight (LMW) oligosaccharides and glucose procedures; two process steps were involved, namely the first process involved thermal pretreatment followed by a second process with dilute acid hydrolysis. In the present work, attempt was made to exclude dilute acid hydrolysis stage in order to establish that DIC process alone is sufficient for total polysaccharides conversion into LMW mainly glucose fraction. Information gathered from quantitative and statistical analysis on (i) exploratory studies, (ii) kinetic models from RSM of DIC process and (iii) kinetic data based on experimental works during dilute acid hydrolysis study; support the assumption that DIC treatment alone is sufficient for the total conversion required.

La lipémie postprandiale se caractérise par une augmentation des lipoprotéines riches en triglycérides après un repas, et joue un rôle important dans la biodisponibilité des lipides alimentaires pour les tissus périphériques. En effet, une lipémie postprandiale élevée est souvent associée à l'obésité et à une dyslipidémie, deux composantes du syndrome métabolique qui peuvent engendrer des complications médicales, incluant diabète et maladies cardiovasculaires. La lactoferrine (Lf) inhibe l'épuration hépatique des chylomicrons, conduisant à une élévation de la lipémie postprandiale par des mécanismes moléculaires non élucidés. Il est aussi établi que le Lipolysis Stimulated Receptor (LSR) contribuait à l'épuration des lipoprotéines riches en triglycérides pendant la phase postprandiale. L'objectif était de déterminer s'il existait une interaction entre la Lf et le LSR. Les études de cultures cellulaires ont montré que si la Lf n'affectait pas le taux d'expression du LSR dans des cellules Hepa 1-6 de souris, elle co-localisait avec le LSR en présence d'oléate, un composé requis pour l'activation du récepteur. Des expériences de ligand-blotting ont également montré que la Lf se fixait sur le LSR purifié et inhibait la fixation de lipoprotéines riches en triglycérides. Les domaines N et C-terminaux isolés de cette protéine, ainsi qu'un mélange de peptides obtenu après double hydrolyse de la Lf par la trypsine et la chymotrypsine, conservent cette propriété. Nous proposons que l'élévation de la lipémie postprandiale observée in vivo suite à un traitement par la Lf soit médiée par son interaction avec le LSR, inhibant ainsi l'épuration des chylomicrons et de leurs remnants / Postprandial lipemia is characterized by an increase in plasma triglyceride-rich lipoproteins after the ingestion of meal, and is important towards determining the bioavailability of dietary lipids amongst the peripheral tissues. Indeed, elevated postprandial lipemia is often observed with obesity and dyslipidemia, two disorders that can lead to health complications including diabetes and cardiovascular diseases. Lactoferrin (Lf), has been shown to inhibit hepatic chylomicron remnant removal, resulting in increased postprandial lipemia, for which the molecular mechanisms remain unclear. The lipolysis stimulated lipoprotein receptor (LSR) has been shown to contribute to the removal of triglycerides-rich lipoproteins during the postprandial phase. The aim was to determine if there was interaction between Lf and LSR. Both Lf and LSR were purified with purities upper to 95% and characterized. Cell culture studies demonstrated that while Lf does not have any significant effect on LSR protein levels in mouse Hepa1-6 cells, it co-localizes with LSR in cells, but only in the presence of oleate, which is needed to obtain LSR in its active form. Ligand blotting using purified LSR revealed that Lf binds directly to the receptor in the presence of oleate and prevents the binding of triglycerides-rich lipoproteins. Both C- and N-lobes of Lf, and a mixture of peptides derived from its tryptic and chymotryptic double hydrolysis retained the ability to bind LSR. We propose that the elevated postprandial lipemia observed upon Lf treatment in vivo is mediated by its direct interaction with LSR, thus preventing clearance of chylomicrons and their remnants through the LSR pathway

L’hydrogène peut être utilisé (et est utilisé depuis peu) comme un vecteur d’énergie propre. Il permet la transition du monde énergétique actuel, basé sur les énergies fossiles, vers le monde énergétique futur basé sur les énergies renouvelables et l’hydrogène. Cette transition ne sera envisageable que lorsque les problématiques liées à la production en masse de l’hydrogène et à son stockage seront résolues.L’objectif de ce travail de thèse est de produire l’hydrogène à partir de matériaux à base de magnésium en utilisant deux méthodes : (i) l’hydrolyse et (ii) la méthode micro-ondes.Notre premier objectif était d’élaborer des matériaux pour lesquels le phénomène de passivation du magnésium serait limité et présenteraient ainsi des rendements de production d’hydrogène optimaux. Le broyage mécanique à haute énergie est utilisé pour élaborer les différents composites à base de magnésium ou de son hydrure (Mg – 10 % en masse Additifs) afin d’accentuer la corrosion de ces derniers. Nous avons essentiellement focalisé nos efforts sur l’effet des additifs (i.e. Métaux de transition, Carbone et Oxydes) sur la réaction d’hydrolyse. Les tests d’hydrolyse ont été effectués dans une solution contenant 35 g/L NaCl (i.e. eau de mer). Notre stratégie, pour la résolution des problèmes de cinétique d’absorption/désorption (très lentes même à haute température (i.e. 350°C)), est basée essentiellement sur l’application de l’énergie micro-ondes. Notre deuxième objectif est donc l’utilisation des micro-ondes pour déshydrurer plus rapidement l’hydrure de magnésium (MgH2 – C) grâce à une élévation de température très rapide par rapport au procédé conventionnel. On a traité l’effet des irradiations micro-ondes sur la cinétique de désorption de mélange MgH2 – C, la morphologie et les propriétés de la poudre après un traitement micro-ondes. D’autre part, nous avons présenté une perspective possible de l’application des micro-ondes : la production de fines poudres de titane à partir de son hydrure. / A drastic reduction of emissions requires a partial or a full phase-out of fossil fuels and switch to renewable based energy production. Hydrogen appears to be a potential candidate to replace hydrocarbon fuels for producing clean energy. In this context, production and storage of hydrogen is one of the key challenges in developing the hydrogen economy.The objective of this thesis is to produce hydrogen from Mg-based materials using (i) hydrolysis and (ii) microwaves methods.The first aim of this thesis is to elaborate Mg-based materials with good hydrolysis kinetics and high yield of hydrogen generation (i.e. reducing the formation of the passivation layer on magnesium). For this study, we focalize essentially on the effect of various additives (Transition metals, Carbon or Oxides) on the hydrolysis reaction of Mg-based materials. The mixtures were prepared by ball milling. Chloride solution (3.5 wt. % NaCl, i.e. sea water) was used as reaction medium to beneficiate of chloride ions effect. Our strategy, to solve the problems related to the low absorption/desorption kinetics (even at high temperature (i.e. 350°C) of Mg-based materials, is based on microwaves energy application. Our second goal for this thesis is to investigate the dehydriding reaction of magnesium hydride catalyzed by carbon (i.e.MgH2 – C) under microwave irradiations. We have studied the effects of microwaves on the kinetics of hydrogen desorption, the morphology and sorption properties of Mg powder after microwave treatment. On the other hand, we have presented another microwaves application which appears very promising: production of fine titanium powder from titanium hydride.

Das Ziel der Dissertation ist die Charakterisierung und Optimierung der Prozessbedingungen beim Hochgeschwindigkeitsdrahtflammspritzen. Dazu werden diagnostische Methoden wie das LDA-Verfahren, die Bewertung von Schichten und numerische Betrachtungen herangezogen. Verschiedene Spritzzusatzwerkstoffe wie Massiv- und Fülldrähte sowie hoch- und niedrigschmelzende Materialien werden verarbeitet. Zur Bewertung der Gebrauchseigenschaften erfolgen Korrosions- und Verschleißtests. Aus den Untersuchungsergebnissen resultieren Hinweise und Konzepte zur Verbesserung der Brennertechnik. Die Entwicklung eines neuen HVCW-Systems wird vorgestellt, welches Spritzpartikelgeschwindigkeiten im Überschallbereich ermöglicht, die deutlich über denen klassischer Systeme liegen. In einem gesonderten Abschnitt der Dissertation wird ein neuartiges Verfahren zur Herstellung hydrolysefähigen Materials vorgestellt. Der hergestellte Al-Sn-Werkstoff zersetzt sich in Kontakt mit Wasser unter Abgabe großer Mengen Wasserstoff in kürzester Zeit vollständig.

L'objectif de ce travail est de générer in situ des particules de dioxyde de titane dans une matrice polypropylène fondu au cours du procédé d'extrusion. La synthèse est basée sur des réactions d'hydrolyse-condensations d'un alkoxyde de titane (le n-tétrabutoxyde de titane). Une approche en milieu modèle a tout d'abord été développée offrant l'avantage de pouvoir travailler en milieu liquide sans prendre en compte de la viscosité du PP ni des effets de cisaillement. En se basant sur les données cinétiques déterminées en milieu modèle, la génération de ces particules de dioxyde titane a été ensuite transposée et modélisée dans le milieu polymère de masse molaire plus élevée. Les analyses chimique, structurale et morphologique ont permis de mettre au point l'élaboration in situ de nanocomposites PP/TiO2 présentant unestructure fractale avec des propriétés viscoélastiques particulières. Enfin l'étude des propriétés bactérienne de ce nanocomposite a mis en avant son pouvoir bactéricide (6Log) pour un taux de charge de 9 % massique.

Actin is one of the most abundant and highly conserved proteins in eukaryotic cells. The globular protein assembles into long filaments, which form a variety of different networks within the cytoskeleton. The dynamic reorganization of these networks - which is pivotal for cell motility, cell adhesion, and cell division - is based on cycles of polymerization (assembly) and depolymerization (disassembly) of actin filaments. Actin binds ATP and within the filament, actin-bound ATP is hydrolyzed into ADP on a time scale of a few minutes. As ADP-actin dissociates faster from the filament ends than ATP-actin, the filament becomes less stable as it grows older. Recent single filament experiments, where abrupt dynamical changes during filament depolymerization have been observed, suggest the opposite behavior, however, namely that the actin filaments become increasingly stable with time. Several mechanisms for this stabilization have been proposed, ranging from structural transitions of the whole filament to surface attachment of the filament ends. The key issue of this thesis is to elucidate the unexpected interruptions of depolymerization by a combination of experimental and theoretical studies. In new depolymerization experiments on single filaments, we confirm that filaments cease to shrink in an abrupt manner and determine the time from the initiation of depolymerization until the occurrence of the first interruption. This duration differs from filament to filament and represents a stochastic variable. We consider various hypothetical mechanisms that may cause the observed interruptions. These mechanisms cannot be distinguished directly, but they give rise to distinct distributions of the time until the first interruption, which we compute by modeling the underlying stochastic processes. A comparison with the measured distribution reveals that the sudden truncation of the shrinkage process neither arises from blocking of the ends nor from a collective transition of the whole filament. Instead, we predict a local transition process occurring at random sites within the filament. The combination of additional experimental findings and our theoretical approach confirms the notion of a local transition mechanism and identifies the transition as the photo-induced formation of an actin dimer within the filaments. Unlabeled actin filaments do not exhibit pauses, which implies that, in vivo, older filaments become destabilized by ATP hydrolysis. This destabilization can be identified with an acceleration of the depolymerization prior to the interruption. In the final part of this thesis, we theoretically analyze this acceleration to infer the mechanism of ATP hydrolysis. We show that the rate of ATP hydrolysis is constant within the filament, corresponding to a random as opposed to a vectorial hydrolysis mechanism. / Aktin ist eines der am häufigsten vorkommenden und am stärksten konservierten Proteine in eukaryotischen Zellen. Dieses globuläre Protein bildet lange Filamente, die zu einer großen Vielfalt von Netzwerken innerhalb des Zellskeletts führen. Die dynamische Reorganisation dieser Netzwerke, die entscheidend für Zellbewegung, Zelladhäsion, und Zellteilung ist, basiert auf der Polymerisation (dem Aufbau) und der Depolymerisation (dem Abbau) von Aktinfilamenten. Aktin bindet ATP, welches innerhalb des Filaments auf einer Zeitskala von einigen Minuten in ADP hydrolysiert wird. Da ADP-Aktin schneller vom Filamentende dissoziiert als ATP-Aktin, sollte ein Filament mit der Zeit instabiler werden. Neuere Experimente, in denen abrupte dynamische Änderungen während der Filamentdepolymerisation beobachtet wurden, deuten jedoch auf ein gegenteiliges Verhalten hin: Die Aktinfilamente werden mit der Zeit zunehmend stabiler. Mehrere Mechanismen für diese Stabilisierung wurden bereits vorgeschlagen, von strukturellen Übergängen des gesamten Filaments bis zu Wechselwirkungen der Filamentenden mit dem experimentellen Aufbau. Das zentrale Thema der vorliegenden Dissertation ist die Aufklärung der unerwarteten Unterbrechungen der Depolymerisation. Dies geschieht durch eine Kombination von experimentellen und theoretischen Untersuchungen. Mit Hilfe neuer Depolymerisationexperimente mit einzelnen Filamenten bestätigen wir zunächst, dass die Filamente plötzlich aufhören zu schrumpfen und bestimmen die Zeit, die von der Einleitung der Depolymerisation bis zum Auftreten der ersten Unterbrechung vergeht. Diese Zeit unterscheidet sich von Filament zu Filament und stellt eine stochastische Größe dar. Wir untersuchen daraufhin verschiedene hypothetische Mechanismen, welche die beobachteten Unterbrechungen verursachen könnten. Die Mechanismen können experimentell nicht direkt unterschieden werden, haben jedoch verschiedene Verteilungen für die Zeit bis zur ersten Unterbrechung zur Folge. Wir berechnen die jeweiligen Verteilungen, indem wir die zugrundeliegenden stochastischen Prozesse modellieren. Ein Vergleich mit der gemessenen Verteilung zeigt, dass der plötzliche Abbruch des Depolymerisationsprozesses weder auf eine Blockade der Enden, noch auf einen kollektiven strukturellen Übergang des gesamten Filaments zurückzuführen ist. An Stelle dessen postulieren wir einen lokalen Übergangsprozess, der an zufälligen Stellen innerhalb des Filaments auftritt. Die Kombination von weiteren experimentellen Ergebnissen und unserem theoretischen Ansatz bestätigt die Vorstellung eines lokalen Übergangsmechanismus und identifiziert den Übergang als die photo-induzierte Bildung eines Aktindimers innerhalb des Filaments. Nicht fluoreszenzmarkierte Aktinfilamente zeigen keine Unterbrechungen, woraus folgt, dass ältere Filamente in vivo durch die ATP-Hydrolyse destabilisiert werden. Die Destabilisierung zeigt sich durch die Beschleunigung der Depolymerisation vor der Unterbrechung. Im letzten Teil der vorliegenden Arbeit untersuchen wir diese Beschleunigung mit theoretischen Methoden, um auf den Mechanismus der ATP-Hydrolyse zu schließen. Wir zeigen, dass die Hydrolyserate von ATP innerhalb des Filaments konstant ist, was dem sogenannten zufälligen Hydrolysemechanismus entspricht und im Gegensatz zum sogenannten vektoriellen Mechanismus steht.